SUPPLEMENTARY MATERIAL Jens Mattow, Ilja Demuth, Gisela Haeselbarth, Peter R. Jungblut, Joachim Klose Selenium-binding protein 2, the major hepatic target.

Slides:



Advertisements
Similar presentations
DNA.
Advertisements

The Expression of NPPA Splice Variants During Cardiac Differentiation of Mouse Mesenchymal and Embryonic Stem Cells Masoumeh Fakhr Taha PhD, Arash Javeri.
B1b 6.1 Inheritance Keywords:
Classical Genetics. Humans have a long history of animal and plant breeding… but without an understanding of the underlying process Humans have a long.
What does chocolate have to do with genetics? Click the mouse to start.
CISC667, F05, Lec24, Liao1 CISC 667 Intro to Bioinformatics (Fall 2005) DNA Microarray, 2d gel, MSMS, yeast 2-hybrid.
Sexual and Asexual Reproduction
DNA = Deoxyribonucleic Acid. Inherited from your parents Genetic material Determines an organism’s traits.
Genetic Alterations of TP53 Gene in Brain Astrocytic Tumours Methodology Θ Eighty-three brain tumor biopsies were collected and used in this study. Thirty.
-The methods section of the course covers chapters 21 and 22, not chapters 20 and 21 -Paper discussion on Tuesday - assignment due at the start of class.
WT ospti1a EV HAstrepII -OsPti1a OsPti1a -HAstrepII OsPti1a CBB WB: anti-HA antibody BA C OsPti1a -HAstrepII EV ospti1aWT EV HAstrepII -OsPti1a.
PROTEIN STRUCTURE NAME: ANUSHA. INTRODUCTION Frederick Sanger was awarded his first Nobel Prize for determining the amino acid sequence of insulin, the.
DNA fingerprinting. DNA fingerprinting is used to determine paternity Look at the DNA of the mother, father and child Could these parents produce this.
Section 3.0 DNA is the Inherited Material Responsible for Variation.
Lesson Overview Lesson Overview Human Chromosomes Objectives 14.1 Human Chromosomes - -Identify the types of human chromosomes in a karotype. -Describe.
Today: Genomic Imprinting and Epigenetics. haploid diploid X 23 in humans X 23 in humans X 23 in humans Inheritance = The interaction between genes inherited.
Cell Division.
Human Influence on Genes. Why Analyze DNA? Check for diseases Check for diseases Identify parents Identify parents Crime scene investigations Crime scene.
 passing on of characteristics from parents to offspring.
Recombinant DNA Technology Chapter 15. In the 1950s, the basic structure of DNA had been revealed, however, no one could figure out how to reveal the.
Spot number ; H1 Supporting Information Figure 3. MS spectra of the identified proteins.
© 2013 Pearson Education, Inc. Extensions of Mendelian Genetics  Incomplete Dominance is when a heterozygote expresses a phenotype intermediate between.
Human Karyotype New Journal Entry – “Human Karyotype” 1. How is DNA arranged in our cells? 2. How many chromosomes do humans have?
How Do Traits Get Passed On? LESSON 4. Move to which corner you think is correct for each question Can offspring get instructions for the variation of.
Chromosomes. Human Chromosome Autosomes – (#1-22) 44 chromosomes that everyone has no matter what sex they are Autosomes – (#1-22) 44 chromosomes that.
Understanding PEDIGREEs.
GENOME ORGANIZATION AS REVEALED BY GENOME MAPPING WHY MAP GENOMES? HOW TO MAP GENOMES?
MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.
Keratins as Susceptibility Genes for End-Stage Liver Disease
Epidermolysis Bullosa: Novel and De Novo Premature Termination Codon and Deletion Mutations in the Plectin Gene Predict Late-Onset Muscular Dystrophy 
Living organisms are distinguished by their ability to reproduce their own kind Offspring resemble their parents They have similar characteristics.
Volume 7, Issue 2, Pages (February 2014)
DNA Fingerprinting MiniLab
Distinct Ezrin Truncations Differentiate Metastases in Sentinel Lymph Nodes from Unaffected Lymph Node Tissues, from Primary Breast Tumors, and from Healthy.
Comparison of Caspase Activation and Subcellular Localization in HL-60 and K562 Cells Undergoing Etoposide-Induced Apoptosis by Luis M. Martins, Peter.
Cosuppression in Drosophila: Gene Silencing of Alcohol dehydrogenase by white-Adh Transgenes Is Polycomb Dependent  Manika Pal-Bhadra, Utpal Bhadra, James.
GENETICS A Conceptual Approach
STEVE S. SOMMER, M.D., Ph.D.  Mayo Clinic Proceedings 
Expression levels from the HIS3 gene and growth during histidine starvation are optimised by the natural HIS3 codon usage in yeast Start codon clearance.
Figure S1. Comparison of synthesized proteins in R. sphaeroides 2. 4
Skin-Specific Expression of ank-393, a Novel Ankyrin-3 Splice Variant
(A) Block diagram of the precursor proteins predicted from the Oak1, 2, 3, and 4 clones showing the signal peptide (light shading), the regions corresponding.
Anti-ACTL7a antibodies: a cause of infertility
Epigenetic inheritance in the mouse
Volume 27, Issue 23, Pages e5 (December 2017)
The transmission of traits from one generation to the next is called inheritance, or heredity.
ATLAS: A System to Selectively Identify Human-Specific L1 Insertions
Secretion assays are shown for pCASP plasmid, strain variations, and silks. Secretion assays are shown for pCASP plasmid, strain variations, and silks.
Epidermolysis Bullosa: Novel and De Novo Premature Termination Codon and Deletion Mutations in the Plectin Gene Predict Late-Onset Muscular Dystrophy 
Overview of Genetics.
Keratins as Susceptibility Genes for End-Stage Liver Disease
Volume 17, Issue 21, Pages (November 2007)
Asexual vs. Sexual Reproduction
Volume 7, Issue 8, Pages (August 2000)
Volume 17, Issue 8, Pages (August 2010)
GENETICS A Conceptual Approach
Volume 11, Issue 2, Pages (January 2001)
Volume 70, Issue 2, Pages (July 2006)
Linear Mitochondrial Plasmids of F
Posttranscriptional Gene Silencing Is Not Compromised in the Arabidopsis CARPEL FACTORY (DICER-LIKE1) Mutant, a Homolog of Dicer-1 from Drosophila  E.Jean.
Transglutaminase-3 Enzyme: A Putative Actor in Human Hair Shaft Scaffolding?  Sébastien Thibaut, Nükhet Cavusoglu, Emmanuelle de Becker, Franck Zerbib,
Volume 28, Issue 1, Pages e3 (January 2018)
Volume 58, Issue 2, Pages (August 2000)
Volume 4, Issue 1, Pages (January 1996)
Objective -1 Gene structure and organisation..
1. What animal 2. Male or Female ? 4. Male or Female? Why? Why?
Volume 6, Issue 4, Pages (October 2007)
Volume 93, Issue 1, Pages (April 1998)
BC Science Connections 10
Volume 4, Issue 1, Pages (January 1996)
Presentation transcript:

SUPPLEMENTARY MATERIAL Jens Mattow, Ilja Demuth, Gisela Haeselbarth, Peter R. Jungblut, Joachim Klose Selenium-binding protein 2, the major hepatic target for acetaminophen, shows sex differences in protein abundance Electrophoresis, submitted.

Mother: CalzinatoFather: Aarhus Mother: AarhusFather: Calzinato Mother: CalzinatoFather: Aarhus Mother: AarhusFather: Calzinato Male 1 Female 1Female 2 Female 3Female 4 Female 5 Female 6 Male 1Male 3Male 2 Male 1Male 2Female 1Female 2Female 3Female 4Female 5Female 6 Female 1Female 2Male 1Male 2Male 3Male 4Male 5 Family 1 Family 2 Family 3 Family 4 Parents F 1 (CxA) Hybrids Parents F 1 (AxC) Hybrids Parents F 1 (CxA) Hybrids Parents F 1 (AxC) Hybrids Females vs. Males 5216* 5205* 4303* 4301* * 6805, 6809, 7814*, 8810*

Figure legend Silver-stained 2-DE patterns of cytosolic liver proteins were investigated in 8 parental mice (4 females; 4 males) of 2 subspecies, namely Mus musculus musculus (inbred strain: Calcinato B) and Mus musculus domesticus (inbred strain: Aarhus), as well as in their offspring (25 F 1 hybrids; 14 females; 11 males). The primary goal of this analysis was to identify strain-specific protein variants, which reveal a mode of inheritance compatible with the concept of genomic imprinting. In this context, the protein patterns of the parental mice (2 replicate gels per animal) were compared with each other to elucidate strain- as well as sex-dependent protein variations. The figure depicts sectors from the protein patterns of all 33 mice investigated. The 10 protein spots labeled showed very low intensities in female mice (left side), but high intensities in males (right side). Seven of these spots (marked by asterisks) were unambiguously identified as SBP2 by MALDI-MS. The remaining 3 protein spots (SSP5514, SSP6805, SSP6809) most likely represent additional SBP2 variants, but were not analyzed by MS, due to their absence in preparative CBB G250 stained 2-DE gels. Edman degradation revealed that SSP6613 represents an N-terminally truncated SBP2 variant, which lacks the amino acids of the full-length protein. Similarly, protein spots SSP5216 and SSP5205 were identified as SBP2 variants lacking the amino acids and 1-225, respectively. Edman degradation of SSP8810 did not reveal any sequence data suggesting that this protein spot represents an N-terminally blocked full-length SBP2 variant. For reasons of clarity the spot labels are abbreviated, e.g. protein spot SSP8810 is designated as Please note that only the parental mice were analyzed in detail to elucidate sex- dependent protein variations. However, reproducible sex differences in SBP2 abundance were also detected in the 25 F 1 hybrids.