Introduction to Bioinformatics (Lecture for CS397-CXZ Algorithms in Bioinformatics) Jan. 21, 2004 ChengXiang Zhai Department of Computer Science University.

Slides:

Advertisements

Similar presentations

Prof. Carolina Ruiz Computer Science Department Bioinformatics and Computational Biology Program WPI WELCOME TO BCB4003/CS4803 BCB503/CS583 BIOLOGICAL.

Advertisements

School of Computer Engineering Master of Science (Bioinformatics) A/P Kwoh Chee Keong 2009 presented by.

 Preparing undergraduates to succeed in college and beyond in a bioinformatics-rich curriculum  Discussion of existing resources, opportunities, and.

Application of Unstructured Learning in Computational Biology Tony C Smith Department of Computer Science University of Waikato

UCSC BIOINFORMATICS Richard Hughey Vice-Chair, Biomolecular Engineering.

Bioinformatics at IU - Ketan Mane. Bioinformatics at IU What is Bioinformatics? Bioinformatics is the study of the inherent structure of biological information.

Bioinformatics: One Minute and One Hour at a Time Laurie J. Heyer L.R. King Asst. Professor of Mathematics Davidson College

The Golden Age of Biology DNA -> RNA -> Proteins -> Metabolites Genomics Technologies MECHANISMS OF LIFE Health Care Diagnostics Medicines Animal Products.

Introduction to Bioinformatics Spring 2008 Yana Kortsarts, Computer Science Department Bob Morris, Biology Department.

Bioinformatics: a Multidisciplinary Challenge Ron Y. Pinter Dept. of Computer Science Technion March 12, 2003.

What is bioinformatics? Finding patterns in molecular biological data Implies: managing molecular biological data identifying correlations in molecular.

Welcome to Chem 434 Bioinformatics March 25, 2008 Review of course prerequisites Review of syllabus Review of Bioinformatics Course website Course objectives.

Workshop in Bioinformatics 2010 What is it ? The goals of the class… How we do it… What’s in the class Why should I take the class..

Scientific Data Mining: Emerging Developments and Challenges F. Seillier-Moiseiwitsch Bioinformatics Research Center Department of Mathematics and Statistics.

BI420 – Course information Web site: Instructor: Gabor Marth Teaching.

Introduction to Bioinformatics (Lecture for CS498-CXZ Algorithms in Bioinformatics) Aug. 25, 2005 ChengXiang Zhai Department of Computer Science University.

Different views of bioinformatics CS view: what are the algorithms, data structures and other concepts needed to develop tools to solve biological problems.

Structural Bioinformatics Dr. Avraham Samson Course no.: Credit points: 1.5 Final grade is based on 10 assignments Course homepage:

Algorithms in Computational Biology Tanya Berger-Wolf Compbio.cs.uic.edu/~tanya/teaching/CompBio January 13, 2006.

Presented by Liu Qi An introduction to Bioinformatics Algorithms Qi Liu

8/15/2015Bioinformatics and Computational Biology Undergraduate Major 1 Iowa State University College of Liberal Arts and Sciences Bioinformatics & Computational.

Bioinformatics Jan Taylor. A bit about me Biochemistry and Molecular Biology Computer Science, Computational Biology Multivariate statistics Machine learning.

9/30/2004TCSS588A Isabelle Bichindaritz1 Introduction to Bioinformatics.

CS598CXZ Course Summary ChengXiang Zhai Department of Computer Science University of Illinois, Urbana-Champaign.

Page 1 Dan Roth Department of Computer Science University of Illinois at Urbana-Champaign.

Bioinformatics Sean Langford, Larry Hale. What is it?  Bioinformatics is a scientific field involving many disciplines that focuses on the development.

Introduction to Bioinformatics Prologue. Bioinformatics Living things have the ability to store, utilize, and pass on information Bioinformatics strives.

Integrating Bioinformatics into the Life Sciences – Phase 2 Mark Pauley and Bill Tapprich Group #2: Integration.

JM - 1 Introduction to Bioinformatics: Lecture I An Overview of the Course Jarek Meller Jarek Meller Division of Biomedical Informatics,

Master’s Degrees in Bioinformatics in Switzerland: Past, present and near future Patricia M. Palagi Swiss Institute of Bioinformatics.

A New Oklahoma Bioinformatics Company. Microarray and Bioinformatics.

CS397-CXZ Algorithms in Bioinformatics ChengXiang (“Cheng”) Zhai, Robert Skeel (Department of Computer Science) Nick Sahinidis (Department of Chemical.

Sanguinetti, 2011Bio2 lecture 1 Bioinformatics 2 Introduction.

Social Networks in Most Visible Form. Social Networking Techniques in Business Several social networking techniques can help us in reaching maximum number.

Intelligent systems in bioinformatics Introduction to the course.

Bioinformatics Education at North Central College Caroline St.Clair Professor of Computer Science.

Introduction to Bioinformatics Biostatistics & Medical Informatics 576 Computer Sciences 576 Fall 2008 Colin Dewey Dept. of Biostatistics & Medical Informatics.

Harbin Institute of Technology Computer Science and Bioinformatics Wang Yadong Second US-China Computer Science Leadership Summit.

1 Protein Structure Prediction (Lecture for CS397-CXZ Algorithms in Bioinformatics) April 23, 2004 ChengXiang Zhai Department of Computer Science University.

Introduction to Bioinformatics Dr. Rybarczyk, PhD University of North Carolina-Chapel Hill

Master of Science in Biological Informatics PROGRAM DESCRIPTION The MS in Biological Informatics program program aims.

AdvancedBioinformatics Biostatistics & Medical Informatics 776 Computer Sciences 776 Spring 2002 Mark Craven Dept. of Biostatistics & Medical Informatics.

Bioinformatics and Comparative Genome Analyses Course Course web page: EMBO Bioinformatics and Comparative.

Information Technology in the Natural Sciences Biology – Chemistry – Physics.

Data Mining and Decision Trees 1.Data Mining and Biological Information 2.Data Mining and Machine Learning Techniques 3.Decision trees and C5 4.Applications.

EB3233 Bioinformatics Introduction to Bioinformatics.

Bioinformatics Curriculum Issues, goals, curriculum.

Bioinformatics lectures at Rice University Li Zhang Lecture 11: Networks and integrative genomic analysis-3 Genomic data

1  Jointly offered by FOS and SOC beginning from July AY2004/05 (enrollment students)  A multi-disciplinary 4 year program involving 3 Faculty.

COMPUTATIONAL BIOLOGIST DR. MARTIN TOMPA Place of Employment: University of Washington Type of Work: Develops computer programs and algorithms to identify.

Opportunities for Text Mining in Bioinformatics (CS591-CXZ Text Data Mining Seminar) Dec. 8, 2004 ChengXiang Zhai Department of Computer Science University.

2008 © ChengXiang Zhai Dragon Star Lecture at Beijing University, June 21-30, 龙星计划课程 : 信息检索 Course Summary ChengXiang Zhai ( 翟成祥 ) Department of.

An Introduction to NCBI & BLAST National Center for Biotechnology Information Richard Johnston Pasadena City College.

Bioinformatics Professor: Monica Bianchini Department of Information Engineering and Mathematics E–mail: Phone: 1012.

BME435 BIOINFORMATICS.

Bioinformatics Overview

CS498-CXZ Algorithms in Bioinformatics

Course Summary (Lecture for CS410 Intro Text Info Systems)

생물정보학 Bioinformatics.

Algorithms in Computational Biology

Introduction to TIMAN: Text Information Managemetn & Analysis

Bioinformatics Biological Data Computer Calculations +

KEY CONCEPT Entire genomes are sequenced, studied, and compared.

KEY CONCEPT Entire genomes are sequenced, studied, and compared.

KEY CONCEPT Entire genomes are sequenced, studied, and compared.

LESSON 1 INTNRODUCTION HYE-JOO KWON, Ph.D /

Course Summary ChengXiang “Cheng” Zhai Department of Computer Science

KEY CONCEPT Entire genomes are sequenced, studied, and compared.

KEY CONCEPT Entire genomes are sequenced, studied, and compared.

Presentation transcript:

Introduction to Bioinformatics (Lecture for CS397-CXZ Algorithms in Bioinformatics) Jan. 21, 2004 ChengXiang Zhai Department of Computer Science University of Illinois, Urbana-Champaign

Outline What is bioinformatics? Why is bioinformatics important? Bioinformatics and other fields Topics in bioinformatics

What is Bioinformatics No standard definition! Our definition: Management & Exploitation of Biological Information –Biological information (DNA, Gene expression, Proteins, Literature….) –Information management (search, organization, classification) –Information exploitation (pattern analysis, data mining) Other definitions –(Broader) Computer Science + Biology, would cover Computational Biology (biosimulation) Bioimaging, etc –(Biased/Narrow) Only refers to one of the following Information management tool development Analysis of biology data

Why is Bioinformatics Important? Biology perspective –More and more biological information is available –Need for effectively accessing and using the information –Information analysis supplements (even may replace) web lab experiments Computer science perspective –Excellent application domain –Poses special computational challenges –Brings computer science closer to scientific discovery Currently growing …

The Growing Field of Bioinformatics Research: Universities are expanding research programs in bioinformatics Education: New degree programs are being launched Industry: Pharmaceutical industry has a great interest in bioinformatics Many job and funding opportunities Tour of the Course Resource Web Page

Theoretical CS Bioinformatics and Other Fields Molecular Biology Machine Learning Data Mining Information Management Biophysics Bioinformatics Biochemistry Applied Mathematics & Statistics Biology Computer Science

Topics in Bioinformatics > DNA sequence AATTCATGAAAATCGTATACTGGTCTGGTACCGGC TGAGAAAATGGCAGAGCTCATCGCTAAAGGTA TCTGGTAAAGACGTCAACACCATCAACGTGTC ACATCGATGAACTGCTGAACGAAGATATCCTG TTGCTCTGCCATGGGCGATGAAGTTCTCGAGG > Protein sequence MKIVYWSGTGNTEKMAELIAKGIIESGKDV DELLNEDILILGCSAMGDEVLEESEFEPFIE KVALFGSYGWGDGKWMRDFEERMNGYG PDEAEQDCIEFGKKIANI Gene (DNA) Function (Protein) Gene expression & regulation Microarray data (Matrix) Genomics Proteomics transcriptomics