Searching and Regular Expressions. Proteins 20 amino acids Interesting structures beta barrel, greek key motif, EF hand... Bind, move, catalyze, recognize,

Slides:



Advertisements
Similar presentations
Regular Expressions Pattern and Match objects Genome 559: Introduction to Statistical and Computational Genomics Elhanan Borenstein.
Advertisements

BNF. What is BNF? BNF stands for “Backus-Naur Form,” after the people who invented it BNF is a metalanguage--a language used to describe another language.
Python: Regular Expressions
ISBN Regular expressions Mastering Regular Expressions by Jeffrey E. F. Friedl –(on reserve.
LING 388: Language and Computers Sandiway Fong Lecture 2: 8/23.
More Regular Expressions. List/Scalar Context for m// Last week, we said that m// returns ‘true’ or ‘false’ in scalar context. (really, 1 or 0). In list.
Regular expressions Mastering Regular Expressions by Jeffrey E. F. Friedl Linux editors and commands (e.g.
Physical Mapping II + Perl CIS 667 March 2, 2004.
Regular Expressions Comp 2400: Fall 2008 Prof. Chris GauthierDickey.
More on Regular Expressions Regular Expressions More character classes \s matches any whitespace character (space, tab, newline etc) \w matches.
Binary Search Trees continued Trees Draw the BST Insert the elements in this order 50, 70, 30, 37, 43, 81, 12, 72, 99 2.
Last Updated March 2006 Slide 1 Regular Expressions.
“Everything Else”. Find all substrings We’ve learned how to find the first location of a string in another string with find. What about finding all matches?
Lecture 7: Perl pattern handling features. Pattern Matching Recall =~ is the pattern matching operator A first simple match example print “An methionine.
Methods in Computational Linguistics II with reference to Matt Huenerfauth’s Language Technology material Lecture 4: Matching Things. Regular Expressions.
 Text Manipulation and Data Collection. General Programming Practice Find a string within a text Find a string ‘man’ from a ‘A successful man’
Introduction to Computing Using Python Regular expressions Suppose we need to find all addresses in a web page How do we recognize addresses?
CIS 218 Advanced UNIX1 CIS 218 – Advanced UNIX (g)awk.
Strings The Basics. Strings can refer to a string variable as one variable or as many different components (characters) string values are delimited by.
RegExp. Regular Expression A regular expression is a certain way to describe a pattern of characters. Pattern-matching or keyword search. Regular expressions.
CS 403: Programming Languages Fall 2004 Department of Computer Science University of Alabama Joel Jones.
Regular Expressions Regular expressions are a language for string patterns. RegEx is integral to many programming languages:  Perl  Python  Javascript.
Perl and Regular Expressions Regular Expressions are available as part of the programming languages Java, JScript, Visual Basic and VBScript, JavaScript,
Collecting Things Together - Lists 1. We’ve seen that Python can store things in memory and retrieve, using names. Sometime we want to store a bunch of.
LING 388: Language and Computers Sandiway Fong Lecture 6: 9/15.
Python Regular Expressions Easy text processing. Regular Expression  A way of identifying certain String patterns  Formally, a RE is:  a letter or.
CS 330 Programming Languages 10 / 07 / 2008 Instructor: Michael Eckmann.
 Character set is a set of valid characters that a language can recognise.  A character represents any letter, digit or any other sign  Java uses the.
Functions. Built-in functions You’ve used several functions already >>> len("ATGGTCA")‏ 7 >>> abs(-6)‏ 6 >>> float("3.1415")‏ >>>
Review Please hand in your practicals and homework Regular Expressions with grep.
Python uses boolean variables to evaluate conditions. The boolean values True and False are returned when an expression is compared or evaluated.
REGEX. Problems Have big text file, want to extract data – Phone numbers (503)
Introduction Copyright © Software Carpentry 2010 This work is licensed under the Creative Commons Attribution License See
Regular Expressions for PHP Adding magic to your programming. Geoffrey Dunn
BY A Mikati & M Shaito Awk Utility n Introduction n Some basics n Some samples n Patterns & Actions Regular Expressions n Boolean n start /end n.
12. Regular Expressions. 2 Motto: I don't play accurately-any one can play accurately- but I play with wonderful expression. As far as the piano is concerned,
GREP. Whats Grep? Grep is a popular unix program that supports a special programming language for doing regular expressions The grammar in use for software.
May 2008CLINT-LIN Regular Expressions1 Introduction to Computational Linguistics Regular Expressions (Tutorial derived from NLTK)
CS 330 Programming Languages 10 / 02 / 2007 Instructor: Michael Eckmann.
Validation using Regular Expressions. Regular Expression Instead of asking if user input has some particular value, sometimes you want to know if it follows.
Chapter 7 - Sequence patterns1 Chapter 7 – Sequence patterns (first part) We want a signature for a protein sequence family. The signature should ideally.
Operators Copyright © Software Carpentry 2010 This work is licensed under the Creative Commons Attribution License See
Regular Expressions (RegEx). Regular expression is like another language What is a regular expression? Literal (or normal characters) – Alphanumeric abc…ABC…
Finding substrings my $sequence = "gatgcaggctcgctagcggct"; #Does this string contain a startcodon? if ($sequence =~ m/atg/) { print "Yes"; } else { print.
-Joseph Beberman *Some slides are inspired by a PowerPoint presentation used by professor Seikyung Jung, which was derived from Charlie Wiseman.
Introduction to Programming the WWW I CMSC Winter 2003 Lecture 17.
CS 330 Programming Languages 09 / 30 / 2008 Instructor: Michael Eckmann.
May 2006CLINT-LIN Regular Expressions1 Introduction to Computational Linguistics Regular Expressions (Tutorial derived from NLTK)
Winter 2016CISC101 - Prof. McLeod1 CISC101 Reminders Quiz 3 this week – last section on Friday. Assignment 4 is posted. Data mining: –Designing functions.
CSC-305 Design and Analysis of AlgorithmsBS(CS) -6 Fall-2014CSC-305 Design and Analysis of AlgorithmsBS(CS) -6 Fall-2014 Design and Analysis of Algorithms.
Strings in Python String Methods. String methods You do not have to include the string library to use these! Since strings are objects, you use the dot.
Lesson 4 String Manipulation. Lesson 4 In many applications you will need to do some kind of manipulation or parsing of strings, whether you are Attempting.
Regular Expressions In Javascript cosc What Do They Do? Does pattern matching on text We use the term “string” to indicate the text that the regular.
Regular Expressions Copyright Doug Maxwell (
CSE 374 Programming Concepts & Tools
More about comments Review Single Line Comments The # sign is for comments. A comment is a line of text that Python won’t try to run as code. Its just.
Regular Expressions Upsorn Praphamontripong CS 1110
Regular Expressions 'RegEx'.
Strings and Serialization
Looking for Patterns - Finding them with Regular Expressions
CS170 – Week 1 Lecture 3: Foundation Ismail abumuhfouz.
CSC 594 Topics in AI – Natural Language Processing
Regular Expressions and perl
CSC 594 Topics in AI – Natural Language Processing
CS 1111 Introduction to Programming Fall 2018
Regular Expressions and Grep
“Everything Else”.
REGEX.
ADVANCE FIND & REPLACE WITH REGULAR EXPRESSIONS
Presentation transcript:

Searching and Regular Expressions

Proteins 20 amino acids Interesting structures beta barrel, greek key motif, EF hand... Bind, move, catalyze, recognize, block,... Many post-translational modifications Structure/function strongly influenced by sequence

Sequence Suggests Structure/Function When working with tumors you find the p53 tumor antigen, which is found in increased amounts in transformed cells. After looking at many p53s you find that the substring MCNSSCMGGMNRR is well conserved and has few false (mis)matches. If you have a new protein sequence and it has this substring then it is likely to be a p53 tumor antigen.

Finding a string We’ve covered several ways to find a substring in a larger string. site in sequence -- test if the substring site is found anywhere in the sequence sequence.find(site) -- find the index of the first site in the sequence. Return -1 if not found. sequence.count(site) -- count the number of times site is found in the sequence (no overlaps).

Is it a p53 sequence? >>> p53 = "MCNSSCMGGMNRR" >>> protein = "SEFTTVLYNFMCNSSCMGGMNRRPILTIIS" >>> protein.find(p53) 10 >>> protein[10:10+len(p53)] 'MCNSSCMGGMNRR' >>>

p53 needs more than one test substring After a while you find that p53s are variable in one residue. MCNSSCMGGMNRR or MCNSSCVGGMNRR You could test for both cases, but as you add more possibilities the number of patterns gets really large, and writing them out is tedious.

Need a pattern Rather than write each alternative, perhaps we can write a pattern, which is used to describe all the strings to test. MCNSSCMGGMNRR or MCNSSCVGGMNRR MCNSSC[MV]GGMNRR Use [] to indicate a list of residues that could match. [FILAPVM] matches any hydrophobic residue

PROSITE PROSITE is a database of protein patterns. The documentation for a pattern is in PRODOC. PROSITE contains links to SWISS-PROT (a protein sequence database) and PDB (a structure database)

ANTENNAPEDIA 'Homeobox' antennapedia-type protein signature. [LIVMFE][FY]PWM[KRQTA] Look for a substring which: Starts with L, I, V, M, F, or E

ANTENNAPEDIA 'Homeobox' antennapedia-type protein signature. [LIVMFE][FY]PWM[KRQTA] Look for a substring which: Starts with L, I, V, M, F, or E Then has an F or Y

ANTENNAPEDIA 'Homeobox' antennapedia-type protein signature. [LIVMFE][FY]PWM[KRQTA] Look for a substring which: Starts with L, I, V, M, F, or E Then has an F or Y Then the letter P Followed by a W Followed by an M

ANTENNAPEDIA 'Homeobox' antennapedia-type protein signature. [LIVMFE][FY]PWM[KRQTA] Look for a substring which: Starts with L, I, V, M, F, or E Then has an F or Y Then the letter P Followed by a W Followed by an M And ending with a K, R, Q, T, or A

Find ANTENNAPEDIA Can you find [LIVMFE][FY]PWM[KRQTA] ? MDPDCFAMSS YQFVNSLASC YPQQMNPQQN HPGAGNSSAG GSGGGAGGSG GVVPSGGTNG GQGSAGAATP GANDYFPAAA AYTPNLYPNT PQPTTPIRRL ADREIRIWWT TRSCSRSDCS CSSSSNSNSS NMPMQRQSCC QQQQQLAQQQ HPQQQQQQQQ ANISCKYAND PVTPGGSGGG GVSGSNNNNN SANSNNNNSQ SLASPQDLST RDISPKLSPS SVVESVARSL NKGVLGGSLA AAAAAAGLNN NHSGSGVSGG PGNVNVPMHS PGGGDSDSES DSGNEAGSSQ NSGNGKKNPP QIYPWMKRVH LGTSTVNANG ETKRQRTSYT RYQTLELEKE FHFNRYLTRR RRIEIAHALC LTERQIKIWF QNRRMKWKKE HKMASMNIVP YHMGPYGHPY HQFDIHPSQF AHLSA That’s why we have computers.

Sequences with the ANTENNAPEDIA motif [LIVMFE][FY]PWM[KRQTA] Here are some sequences which contain substrings which fit the pattern... LHNEANLRIYPWMRSAGADR PTVGKQIFPWMKES VFPWMKMGGAKGGESKRTR...

Not a given residue Suppose you know from structural reasons that a residue cannot be a proline. You could write [ACDEFGHIKLMNQRSTVWY] That’s tedious, so let’s use a new notation [^P] This matches anything which is not a proline. (Yes, using the ^ is strange. That’s the way it is.)

N-glycosylation site This is the pattern for PS00001, ASN_GLYCOSYLATION N[^P][ST][^P] Match an N, Then anything which isn’t a P, Then an S or T, And finally, anything which isn’t a P

Allow anything Sometimes the pattern can have anything in a given position - it just needs the proper spacing. Could use [ACDEFGHJKLMNPQRSTVWY] but that gets tedious. (Have you noticed how often I use that word?) Instead, let’s make a new notation for “anything” Let’s use the dot, “.”, so that P.P matches a proline followed by any residue followed by a proline.

Barwin domain signature 1 The pattern is: CG[KR]CL.V.N The substring must start with a C, second letter must be a G, third must be a K or R, fourth must be a C, fifth must be an L, sixth may be any residue, seventh must be a V, eight may also be any residue, last must be an N....SSCGKCLSVTNTG...

Repeats Sometimes you’ll repeat yourself repeat yourself. For example, a pattern may require 5 hydrophobic residues between two well conserved regions. You could write it as [ FILAPVM][FILAPVM][FILAPVM][FILAPVM][FILAPVM] but that gets tedious. Again that word. And again we’ll create a new notation. Let’s use {}s with a number inside to indicate how many times to repeat the previous pattern. [FILAPVM]{5}

The {}s repeat the previous pattern. The above matches all of the following AAAAA AAPAP LAPMAVAILA VILLAMAP LAPLAMP And.{6} matches any string of at least length 6.

EGF-like domain signature 1 The pattern for PS00022 is: C.C.{5}G.{2}C Match a C, followed by any residue, followed by a C, followed by 5 residues of any type, then a G, then 2 of any residue type, then a C....VCSNEGKCICQPDWTGKDCS...

Count Ranges Sometimes you may have a range of repeats. For example, a loop can have 3 to 5 residues in it. All of our patterns so far only matched a fixed number of characters, so we need to modify the notation. {m,n} - repeat the previous pattern at least m times and up to n times. For example, A{3, 5} matches AAA, AAAA, and AAAAA but does not match AA nor AATAA.

EGF-like domain signature 2 PS01186 is: C.C.{2}[GP][FYW].{4,8}C Use a spacer of at least 4 residues and up to (and including) 8 residues. RHCYCEEGWAPPDCTTQLKA RHCYCEEGWAPPDECTTQLKA RHCYCEEGWAPPDEQCTTQLK A RHCYCEEGWAPPDEQWCTTQ LKA RHCYCEEGWAPPDEQWICTTQ LKA

{0, 1} ? {0,} * {1,} + Short-hand versions of counts ranges This notation is very powerful and widely used outside of bioinformatics. (I think research on it started in the 1950s). Some repeat ranges are used so frequently that (to prevent tedium, and to make things easier to read) there is special notation for them. “optional” “0 or more” “at least one” What it means

N- and C- terminals Some things only happen at the N- terminal (start of the sequence) or C-terminal (end of the sequence). We don’t have a way to say that so we need - yes, you guessed it - more notation. ^ means the start of the sequence (a ^ inside of []s means “not”, outside means “start”) $ means ends of the sequence

^examples$ ^Astart with an A ^[MPK]start with an M, P, or K E$end with an E [QSN]$end with a Q, S, or N ^[^P] start with anything except P ^A.*E$ start with an A and end with an E

Neuromodulin (GAP-43) signature 1 The pattern for PS00412 is: ^MLCC[LIVM]RR Does match: MLCCIRRTKPVEKNEEADQE Does not match: MMLCCIRRTKPVEKNEEADQE

Endoplasmic reticulum targeting sequence The pattern for PS00014 is: [KRHQSA][DENQ]EL$ Does match: ADGGVDDDHDEL Does not match: ADGGVDDDHDELQ

Regular expressions These sorts of patterns which match strings are called “regular expressions”. (The name “regular” comes from a theoretical model of how simple computers work, and “expressions” because they are written as text.) People don’t like saying “regular expression” all the time so will often say “regexp”, “regex”, or “re”, or (rarely) “rx”.

Many different regexp languages We’ve learned a bit of the “perl5” regular expression language. It’s the most common and is used by Python and other languages. There’s even pcre (perl compatible regular expressions) for C. There are many others: grep, emacs, awk, POSIX, and the shells all use different ways to write the same pattern. PROSITE also has its own unique form (which I didn’t teach because no one else uses it).

regexps in Python The re module in Python has functions for working with regular expressions. >>> import re >>>

The ‘search’ method >>> import re >>> text = "My name is Andrew" >>> re.search(r"[AT]", text) The first parameter is the pattern, as a string. The second is the string to search. I use a r“raw” string here. Not needed, but you should use it for all patterns.

The Match object >>> import re >>> text = "My name is Andrew" >>> re.search(r"[AT]", text) The search returns a “Match” object. Just like a file object, there is no simple way to show it.

Using the match >>> import re >>> text = "My name is Andrew" >>> re.search(r"[AT]", text) >>> match = re.search(r"[AT]", text) >>> match.start() 11 >>> match.end() 12 >>> text[11:12] 'A' >>>

Match a protein motif >>> pattern = r"[LIVMFE][FY]PWM[KRQTA]" >>> seq = "LHNEANLRIYPWMRSAGADR" >>> match = re.search(pattern, seq) >>> match.start() 8 >>> match.end() 14 >>>

If it doesn’t match.. The search returns nothing (the None object) when no match was found. >>> import re >>> pattern = r"[LIVMFE][FY]PWM[KRQTA]" >>> match = re.search(pattern, "AAAAAAAAAAAAAA") >>> print match None >>>

List matching patterns >>> import re >>> pattern = r"[LIVMFE][FY]PWM[KRQTA]" >>> sequences = ["LHNEANLRIYPWMRSAGADR",... "PTVGKQIFPWMKES",... "NEANLKQIFPGAATR",... "VFPWMKMGGAKGGESKRTR"] >>> for seq in sequences:... match = re.search(pattern, seq)... if match:... print seq, "matches"... else:... print seq, "does not have the motif"... LHNEANLRIYPWMRSAGADR matches PTVGKQIFPWMKES matches NEANLKQIFPGAATR does not have the motif VFPWMKMGGAKGGESKRTR matches >>>

Groups Suppose an enzyme modifies a protein, and recognizes the portion of the sequence matching [ASD]{3,5}[LI][^P]{2,5} The modification only occurs on the [IL] residue. I want to know the residue of that one residue, and not the start/end positions of the whole motif. This requires a new notation, groups.

(groups) Use ()s to indicate groups. The first ( is the start of the first group, the second ( is the start of the second group, etc. A group ends with the matching ). >>> import re >>> pattern = r"[ASD]{3,5}([LI])[^P]{2,5}" >>> seq = "EASALWTRD" >>> match = re.search(pattern, seq) >>> print match.start(), match.end() 1 9 >>> match.start(1), match.end(1) 4 5 >>>

Parsing with regexps Groups are great for parsing. Suppose I have the string Name: Andrew Age: 33 and want to get the name and the age values. I can use a pattern with a group for each field. Name: ([^ ]+) +Age: ([ ]+)

Dissecting that pattern Name: ([^ ]+) +Age: ([ ]+) One or more non- space characters (group 1 ) Start with “Name: ” One or more spaces “Age: ” One or more digits (group 2)

Shorthand Name: ([^ ]+) +Age: (\d+) Saying [ ] is tedious (again!) There is special shorthand notation for some of the more common sets. Some others \d = [ ] \w = letters, digits, and the underscore \s = “whitespace” (space, newline, tab, and a few others)

Using it >>> import re >>> text = "Name: Andrew Age: 33" >>> pattern = r"Name: ([^ ]+) +Age: ([ ]+)" >>> match = re.search(pattern, text) >>> match.start(1) 6 >>> match.end(1) 12 >>> match.group(1) 'Andrew' >>> match.group(2) '33' >>>