Electronic Supplementary Material Identification and gene expression profile analysis of a major type of lipoprotein lipase in adult medaka Oryzias latipes.

Slides:

Advertisements

Similar presentations

Figure S1 BY RLKox (d) B CaRLK1 NtGLB1 NtEF1α (h) A CaRLK1 CaAct Figure S1. (A) Expression of CaRLK1 mRNA in response to hypoxia.

Advertisements

Fig. 4-1, p Fig. 4-2, p. 109 Fig. 4-3, p. 110.

The cloning and expression of SNAP-25a and b in zebrafish Maia Lavarias*, Dr. Wendy Boehmler Department of Biology, York College of Pennsylvania, York,

P.464. Table 13-1, p.465 Fig. 13-1, p.466 Fig. 13-2, p.467.

Fig. 11-1, p p. 360 Fig. 11-2, p. 361 Fig. 11-3, p. 361.

Table 6-1, p Fig. 6-1, p. 162 p. 163 Fig. 6-2, p. 164.

Real-Time PCR mRNA quantification. What do mRNA levels tell us? DNA  mRNA  protein Reflect level of gene expression Information about cell response.

PE Biosystems Sequence Detection Systems Real time Detection PCR for Nucleic Acids Quantitation.

Fig. S1 A622 1 MVVSEKSKILIIGGTGYIGKYLVETSAKSGHPTFALIRESTLKNPEKSKLIDTFKSYGVT 60 A622L V V A622.

List of Supplementary Figures and Tables Supplementary Material, Fig. S1: Confirmation that YY1 and NLRP7 directly interact in HEK293T cells. Supplementary.

Analyzing your clone 1) FISH 2) “Restriction mapping” 3) Southern analysis : DNA 4) Northern analysis: RNA tells size tells which tissues or conditions.

Real time RT-PCR Quantitating Gene Expression.

Jingfu wang The role of WT1 gene in neuroblastoma Department of Pediatric Oncology Key Laboratory of Cancer Prevention and Therapy of Tianjin, Tianjin.

How do you identify and clone a gene of interest? Shotgun approach? Is there a better way?

Title: Stress-inducible expression of barley Hva1 gene in transgenic mulberry displays enhanced tolerance against drought, salinity and cold stress Journal.

 DNA (gene mutations, paternity, organs compatibility for transplantations)  RNA  Proteins (gene expression)

PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1.

Overview JGIRASTManatee Length DescriptionThe Glug motifHalomucin [Precursor] Halomucin Table designed by Jay McNair.

Supplementary Figures Fig. 1 Transcript levels of Tissue Factor, PAR-1 and PAR-2 Expression if TF, PAR-1 and PAR-2 was analyzed in unstimulated HUVECs,

GeneEnsembl Gene IDPrimer sequenceAmplicon size(BP) DDAH1ENSMUSG Forward (5'to 3') CCCAGCAAAGGGCATGTC Reverse (5' to 3') CCATCTCCGAGTTGCTCACA.

Supplemental Table 1 Source and authentication of cell lines.

GC-MS based metabolite profiling for flavor characterization of Brassica crops grown with different fertilizer application Tomohiko Fukuda a,d,*, Keiki.

Conclusions 1.Synapsin IIa is expressed in the brain of adult zebrafish, however we did not find expression in the eye, gut, muscle, or heart. 2.The data.

Topic Cloning and analyzing oxalate degrading enzymes to see if they dissolve kidney stones with Dr. VanWert.

Normal skin tissue Supplementary Fig 1A KLF4 has a tumor suppressive function in human skin cancer. Skin cancer tissues were deparaffinized and IHC was.

SYBR Green I Chemistry Detects all double stranded DNA

Supplementary Fig. 1. RT-PCR showed that tumor tissues have elevated Mst1 mRNA levels in most of the HCC patients tested. GAPDH RT-PCR products were shown.

SSA/Ps Syndromic SSA/Ps Sporadic HPs Sporadic Genes differentially expressed ≥ 2-fold in syndromic and sporadic SSA/Ps and hyperplastic.

Fig. S1 Beclin1, ATG3 and LC3B mRNA -real-time quantitative PCR HCT-116 HT-29.

D. Darban, Ph.D Department of Microbiology School of Medicine Alborz University of Medical Sciences 1 Probe and Primer Design.

Characterization of the Nicotiana benthamiana chromomethyltransferase genes, NbCMT3s, in leaf development by virus-induced gene silencing Abstract Results.

Supplementary Fig. 1 ClustalW (2.1) multiple sequence alignment and comparison of deduced partial protein sequences of SOS1 in root tissues of wheat genotypes.

Title: Identification of loci associated with embryo yield in microspore culture of Brassica rapa by segregation distortion analysis Jounal: Plant Cell.

Confirmation by real-time RT-PCR of selected genes differentially expressed in trout swim-up fry (A), juvenile brain (B) and liver (C) based on early nutritional.

Expression Profile of Fatty Acid Metabolism Genes in Preimplantation Blastocysts of Obese and Non-Obese Mice Obes Facts 2012;5:575–586 - DOI: /

Whole transcriptome sequencing reveals photoreceptors mRNA expression in nocturnal cutlass fish during the midnight Ji-Yeon Hyeon1, Jun-Hwan Byun1, Seong-Rip.

PCR Polymerase Chain Reaction

Israel maritime college

Figure 1. Analysis of four different hPRLR mRNA isoforms (L, I, S1a, and S1b) in human breast adipose tissue (Breast AT), sc abdominal.

Ezzatollah Fathi1, Raheleh Farahzadi 2, *, Najmeh Sheikhzadeh3

Cardioprotective SUR2A promotes stem cell properties of cardiomyocytes

by Takashi Kasukabe, Junko Okabe-Kado, and Yoshio Honma

Fig. 4. Bexarotene promotes PPARδ activation of target genes in mouse brain and muscle. Bexarotene promotes PPARδ activation of target genes in mouse brain.

Characterisation of proviral integrations in corrected stem cells Visualisation of COL7A1 sequence by FISH analysis in corrected stem cells at passage.

a b c Fold Change DeltaCt Cell Line ADAR1 ADAR2 Ratio H ,776

Volume 129, Issue 3, Pages (September 2005)

Identification of a Potential Molecular Diagnostic Biomarker in Keloid Disease: Syndecan-1 (CD138) Is Overexpressed in Keloid Scar Tissue Rania A. Bagabir,

Volume 13, Issue 5, Pages (March 2003)

Volume 113, Issue 5, Pages (May 2003)

M. Schwaiger, O. Péter, P. Cassinotti

Size Polymorphisms in the Human Ultrahigh Sulfur Hair Keratin-Associated Protein 4, KAP4, Gene Family Naoyuki Kariya, Yutaka Shimomura, Masaaki Ito

Principles of Real Time PCR

Volume 10, Issue 8, Pages (April 2000)

Identification, description, and expression of E7-less STING isoforms.

Volume 57, Issue 6, Pages (June 2000)

Supplementary Figure 1. Structure of amlexanox

Nonsense mutation of EMX2 is potential causative for uterus didelphysis: first molecular explanation for isolated incomplete müllerian fusion Shan Liu,

Supplementary fig 1: Video showing heart function in zebrafish embryos targeted with morpholino oligonucleotides to reduce Brn-3a and Brn-3b compared with.

Identification and characterization of a novel KRAS rearrangement in metastatic prostate cancer. Identification and characterization of a novel KRAS rearrangement.

Volume 107, Issue 4, Pages (November 2001)

Molecular Cloning and Tissue Expression of the Murine Analog to Human Stratum Corneum Chymotryptic Enzyme Assar Bäckman, Lennart Hansson Journal of.

Location, morphology and gene expression of skin CD8α+MHC II+ cells.

circRNA prediction, sequence determination, and validation.

Mixed infection with Beijing and non-Beijing strains in pulmonary tuberculosis in Taiwan: prevalence, risk factors, and dominant strain J.-Y. Wang, H.-L.

Two cycad AOX genes, CrAOX1 and CrAOX2, showing different expression patterns in thermogenic male cones. Two cycad AOX genes, CrAOX1 and CrAOX2, showing.

Upregulation of Toll-Like Receptors (TLRs) 6, 7, and 8 in Keloid Scars

Lipoprotein lipase is decreased in skeletal muscle of young, lean IR offspring of T2D parents. Lipoprotein lipase is decreased in skeletal muscle of young,

ประกาศกระทรวงอุตสาหกรรม ฉบับที่ 5292 (พ.ศ. 2562)

Lack of pilE expression in NZCM238 is associated with lower TNF-α secretion by 16HBE cells during coculture. Lack of pilE expression in NZCM238 is associated.

Presentation transcript:

Electronic Supplementary Material Identification and gene expression profile analysis of a major type of lipoprotein lipase in adult medaka Oryzias latipes Lu Wang, Gen Kaneko, Shin-Ichiro Takahashi, Shugo Watabe, Hideki Ushio Fisheries Science Corresponding author: Gen Kaneko Department of Aquatic Bioscience, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Yayoi, Bunkyo, Tokyo , Japan Tel: Fax: address:

LPL geneMedaka LPL1Red seabream LPL1Torafugu LPL1Mandarin fish LPLZebrafish LPLGilthead seabream LPLRainbow trout LPLEuropean seabass LPLHouse mouse LPLHuman LPLRed seabream LPL2Torafugu LPL2 Medaka LPL Red seabream LPL TorafuguLPL Mandarin fish LPL Zebrafish LPL Gilthead seabream LPL Rainbow trout LPL European seabass LPL House mouse LPL Human LPL Red seabream LPL TorafuguLPL2 ESM Table 1 Amino acid identities (%) of the N-terminal region among LPLs used in the alignments

LPL geneMedaka LPL1Red seabream LPL1Torafugu LPL1Mandarin fish LPLZebrafish LPLGilthead seabream LPLRainbow trout LPLEuropean seabass LPLHouse mouse LPLHuman LPLRed seabream LPL2Torafugu LPL2 Medaka LPL Red seabream LPL Torafugu LPL Mandarin fish LPL Zebrafish LPL Gilthead seabream LPL Rainbow trout LPL European seabass LPL House mouse LPL Human LPL Red seabream LPL Torafugu LPL2 ESM Table 2 Amino acid identities (%) of the C-terminal region among LPLs used in the alignments

ESM Fig. 1 Relative mRNA levels of medaka LPL1 in various tissues determined by quantitative real-time PCR. Elongation factor 1α (EF1α, a) and β-actin (b) genes were used as internal controls. Bars: Mean + standard deviation (n = 10). Gene-specific primers and TaqMan probes designed from the housekeeping genes for the expression analysis: EF1α (Accession number: NM_ ): Forward primer: CAAGGACGGAAATGCCAGT Reverse primer: TACCGCCGATTTTGTAGACG TaqMan probe: (FAM)-ACCTTCTCGCCCCACCGACAAACCC-(TAMRA) β-actin (Accession number: S74868): Forward primer: CTCCATCGTCCACCGCAA Reverse primer: TGGTCGTCTAGGCCCTG TaqMan probe: (FAM)-CTCCTCCCCAGCCAAACACCCAAC-(TAMRA) ab

ESM Fig. 2 Comparison of cycle threshold values of three housekeeping genes in the different tissues of medaka. Bars: Mean + standard deviation (n = 10).