>gi|1565308|gb|AAB38781.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa] 02-AUG-1996 Gene accession U66041 Plant Physiol. 112, 1399 (1996)

Slides:



Advertisements
Similar presentations
Important modules: Biopython, SQL & COM. Information sources python.org tutor list (for beginners), the Python Package index, on-line help, tutorials,
Advertisements

© Wiley Publishing All Rights Reserved. How Most People Use Bioinformatics.
On line (DNA and amino acid) Sequence Information Lecture 7.
Bioinformatics and Chips Bioinformatics is a very integral part of each step in a chip project. Bioinformatics is a very integral part of each step in.
Sequence Databases April 28, 2005 Learning objectives-Understand how information is stored in GenBank. Learn how to read a GenBank flat file. Learn how.
Scarlet Runner Bean Genome Assembly Nancy Phang June 4, 2004.
Archives and Information Retrieval
Phage? New Sequence Horizontal Transfer Molecular Evolution.
Sequence Databases June 21, 2005 Learning objectives-Understand how information is stored in GenBank. Learn how to read a GenBank flat file. Learn how.
ECE 501 Introduction to BME
Summary 1.Eukaryotic cells keep genetic information in DNA enclosed in cell nucleus and mitochondria and chloroplasts (plants); 2.The genomes of several.
BME 130 – Genomes Lecture 7 Genome Annotation I – Gene finding & function predictions.
Sequence Databases – 20 June 2008 Learning objectives- Be able to describe how information is stored in GenBank. Be able to read a GenBank flat file. Be.
Sequence Databases – 21 June 2007 Learning objectives- Be able to describe how information is stored in GenBank. Be able to read a GenBank flat file. Be.
Bioinformatics for your classroom Seth Bordenstein Discover the Microbes Within! March 12, 2006 NCBI BLAST 1. No programming skills needed 2.Familiarity.
BIOLOGY 3020 Fall 2008 Gene Hunting (DNA database searching)
Arabidopsis Gene Project GK-12 April Workshop Karolyn Giang and Dr. Mulligan.
Wellcome Trust Workshop Working with Pathogen Genomes Module 1 Artemis.
On line (DNA and amino acid) Sequence Information
AP Biology: Chapter 14 DNA Technologies
Arabidopsis Genome Annotation TAIR7 Release. Arabidopsis Genome Annotation  Overview of releases  Current release (TAIR7)  Where to find TAIR7 release.
WIBR Bioinformatics, © Whitehead Institute, 2004 Relational Databases for Biologists: Efficiently Managing and Manipulating Your Data Robert Latek, Ph.D.
Essential Bioinformatics and Biocomputing Module (Tutorial) Biological Databases Lecturer: Chen Yuzong Jan 2003 TAs: Cao Zhiwei Lee Teckkwong, Bernett.
Insulin Produced by beta-cells in pancreas Hormone involved in regulation of blood glucose levels tells liver, muscle and fat cells to take up glucose.
Biological databases Nicky Mulder:
Overview of Biological Databases (Lecture for CS498-CXZ Algorithms in Bioinformatics) Sept. 6, 2005 ChengXiang Zhai Department of Computer Science University.
AP Biology Biotechnology Part 2 Genetics of Bacteria.
Topic 3 Genetics 3.1 Genes.
Protein Synthesis. Transcription DNA  mRNA Occurs in the nucleus Translation mRNA  tRNA  AA Occurs at the ribosome.
TCR Identification February 13, The elusive TCR “The study of the T cell receptor has been the subject of many studies, many of which have led to.
Oryza Arjan van Zeijl Claire Lessa Alvim Kamei Robert van Loo Ruud Heshof BIF
NCBI Literature Databases: PubMed
Rice Proteins Data acquisition Curation Resources Development and integration of controlled vocabulary Gene Ontology Trait Ontology Plant Ontology
Lecture 2: Introduction to Computational Biology
Computer Storage of Sequences
Chapter 6 PART II: Concepts in Molecular Biology and Genetics The Human Genome: Implications for the Understanding of Human Disease Companion site for.
Lecture 18 – Functional Genomics Based on chapter 8 Functional and Comparative Genomics Copyright © 2010 Pearson Education Inc.
Define each of these terms: Chromosome: Gene: Allele: Genome: Mutation:
Bioinformatics Workshops 1 & 2 1. use of public database/search sites - range of data and access methods - interpretation of search results - understanding.
Introducing Database Mining to Molecular Genetics Students (Juniors & Seniors) Karl Wilson.
A Molecular Toolkit AP Biology Fall The Scissors: Restriction Enzymes  Bacteria possess restriction enzymes whose usual function is to cut apart.
Finding genes in the genome
Important modules: Biopython, SQL & COM. Information sources  python.org  tutor list (for beginners), the Python Package index, on-line help, tutorials,
CDS 24mer marks in promoter regions actin-depolymerizing factor 2 gene (AY ) zinc-finger DNA binding protein gene (PETZFDB3) Sense batch1Sense batch2.
GENBANK FILE FORMAT LOCUS –LOCUS NAME Is usually the first letter of the genus and species name, followed by the accession number –SEQUENCE LENGTH Number.
Bioinformatics. History Margaret Dayhoff, 1965: Atlas of Protein Sequence and Structure Brookhaven, 1970s: Protein Data Bank (PDB) Needleman & Wunsch,
COURSE OF BIOINFORMATICS Exam_30/01/2014 A.
Supplementary Fig 1. Multiple sequence alignment of nucleotide sequences from amplified region of different Oryza sativa lines and wild species of rice.
Web services and genome annotation in GRID by DNA Data Bank of Japan (DDBJ) Center for Information Biology and DNA Data Bank of Japan National Institute.
Bioinformatics Computing 1 CMP 807 – Day 4 Kevin Galens.
Supplementary Fig. 1 ClustalW (2.1) multiple sequence alignment and comparison of deduced partial protein sequences of SOS1 in root tissues of wheat genotypes.
Genetic Code and Interrupted Gene Chapter 4. Genetic Code and Interrupted Gene Aala A. Abulfaraj.
Protein Synthesis. One Gene – One Enzyme Protein Synthesis.
Risheng Chen et al BMC Genomics
Supplementary Fig. 1 Supplementary Figure 1. Distributions of (A) exon and (B) intron lengths in O. sativa and A. thaliana genes. Green bars are used.
Figure 6: BTK splice variants in B cell precursor leukemia
Protein Synthesis Molecular Biology
Sequence File Formats.
Wolbachia Bioinformatics
Retrieving Information: Using Entrez
Bioinformatics for your classroom
Significant observations
Welcome to the Protein Database Tutorial
Supplemental Figure 3 A B C T-DNA 1 2 RGLG1 2329bp 3 T-DNA 1 2 RGLG2
Week 5 Discussion Section
Volume 9, Issue 11, Pages (November 2016)
Volume 10, Issue 6, Pages (June 2017)
DNA Interlude.
How to search NCBI.
Presentation transcript:

>gi| |gb|AAB | ADP-glucose pyrophosphorylase large subunit [Oryza sativa] 02-AUG-1996 Gene accession U66041 Plant Physiol. 112, 1399 (1996) gene registration Kavakli,H.I., Wu,Y. and Okita,T.W. Agl2 Agl3 >gi| |pir||T02965 glucose-1-phosphate adenylyltransferase (EC ) large chain – rice 20-JUN-2000 Gene accession D APR-1995 Satozawa,T., Akagi,H., Sakamoto,M., Baba,T., Shimada,H. and Fujimura,T. Agl1 >gi| |dbj|BAC | putative glucose-1-phosphate adenylyltransferase large subunit 2 [Oryza sativa (japonica cultivar-group)] 29-MAR-2003 Gene accession AP AUTHORS Sasaki,T., Matsumoto,T. and Yamamoto,K. chromosome 7 genomic DNA 発現していない! Agl4 > gi| |dbj|AK |[ ] Oryza sativa (japonica cultivar- group) cDNA clone:J023098M19, full insert sequence 18-JUL-2003 Gene accession AK Protein ID AAK Sikka,V.K., Choi,S.-B., Kavakli,I.H., Gupta,S., Ito,H. and Okita,T.W. 発現が極めて弱い?

AK 第一染色体 BAC AP Agl2 Agl3 AK 第五染色体 BAC AC Agl1 AK 第七染色体 BAC AP Agl4 Ak 染色体は不明

OsAgl3 OsAgl2 OsAgl1

>glucose-1-phosphate adenylyltransferase (EC ) large chain - rice gi| |pir||T04156[ ] Gene accession T04156 PLN 11-MAY-2000 Chen,M. and Bennetzen,J.L. >gi| |gb|AAK | ADP-glucose pyrophosphorylase large subunit isoform [Oyza ryza sativa] 04-APR-2001 Gene accession AY MAR-2001 Plant Sci. (2001) In press Sikka,V.K., Choi,S.-B., Kavakli,I.H., Gupta,S., Ito,H. and Okita,T.W. ③ Agl3-1 Agl3-2

AY Oryza sativa ADP-...[gi: ] Links LOCUS AY bp mRNA linear PLN 04-APR-2001 DEFINITION Oryza sativa ADP-glucose pyrophosphorylase large subunit isoform mRNA, complete cds. ACCESSION AY VERSION AY GI: KEYWORDS. SOURCE Oryza sativa ORGANISM Oryza sativa Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; Ehrhartoideae; Oryzeae; Oryza. REFERENCE 1 (bases 1 to 1620) AUTHORS Sikka,V.K., Choi,S.-B., Kavakli,I.H., Gupta,S., Ito,H. and Okita,T.W. TITLE Subcellular compartmentation and allosteric regulation of the rice endosperm ADP-glucose pyrophosphorylase JOURNAL Plant Sci. (2001) In press REFERENCE 2 (bases 1 to 1620) AUTHORS Sikka,V.K. and Okita,T.W. TITLE Direct Submission JOURNAL Submitted (03-MAR-2001) Institute of Biological Chemistry, Washington State University, PO Box , Pullman, WA , USA FEATURES Location/Qualifiers source /organism="Oryza sativa" /mol_type="mRNA" /cultivar="Kinmaze" /db_xref="taxon:4530" CDS /codon_start=1 /product="ADP-glucose pyrophosphorylase large subunit isoform" /protein_id="AAK " /db_xref="GI: " /translation="MEFMMPLDTNACAQPMRRAGEGAGTERLMERLNIGGMTQEKALR KRCFGDGVTGTARCVFTSDADRDTPHLRTQSSRKNYADASHVSAVILGGGTGVQLFPL TSTRATPAVPVGGCYRLIDIPMSNCFNSGINKIFVMTQFNSASLNRHIHHTYLGGGIN FTDGSVQVLAATQMPDEPAGWFQGTADAIRKFMWILEDHYNQNNIEHVVILCGDQLYR MNYMELVQKHVDDNADITISCAPIDGSRASDYGLVKFDDSGRVIQFLEKPEGADLESM KVDTSFLSYAIDDKQKYPYIASMGIYVLKKDVLLDILKSKYAHLQDFGSEILPRAVLE HNVKACVFTEYWEDIGTIKSFFDANLALTEQPPKFEFYDPKTPFFTSPRYLPPARLEK CKIKDAIISDGCSFSECTIEHSVIGISSRVSIGCELKDTMMMGADQYETEEETSKLLF EGKVPIGIGENTKIRNCIIDMNARIGRNVIIANTQGVQESDHPEEGYYIRSGIVVILK NATIKHGPII" BASE COUNT 474 a 320 c 393 g 433 t ORIGIN 1 ggcacgagca caagaacact tgggcaggtt tgtctgggac tttgagtacc catggaattc 61 atgatgccat tggatacgaa tgcttgtgca caaccaatga gaagggctgg tgagggtgct 121 gggactgaga ggttgatgga aagattgaat attgggggca tgactcagga gaaagcactg 181 aggaagaggt gctttggtga tggagttact ggaactgcac gatgtgtgtt cacatcagat 241 gctgatagag acactcctca tcttcggaca caatcctccc gaaagaatta tgctgatgca 301 agccacgttt ctgctgtcat tttgggtgga ggcactggag ttcaactctt tcctctgaca 361 agcacaaggg ctacccccgc tgttcctgtt ggaggatgtt acaggcttat tgacatccct 421 atgagcaatt gcttcaatag cggaataaat aaaatatttg tgatgactca gttcaattct 481 gcttctctta atcgccatat ccatcataca taccttggtg gggggatcaa ctttactgat 541 gggtctgtgc aggtattggc tgctacacaa atgcctgacg aaccggctgg atggttccag 601 ggtacagcag atgctatcag aaaatttatg tggatacttg aggatcatta caatcaaaac 661 aacattgagc acgttgtaat cttgtgtgga gatcagcttt acaggatgaa ttacatggag 721 cttgtgcaga aacatgtcga tgacaatgct gacattacca tatcatgtgc tcccatcgac 781 gggagccgag cttctgacta tggactggtg aagtttgatg attcaggccg tgtgatccaa 841 tttcttgaga aaccagaggg tgctgatttg gaatcgatga aagttgatac cagcttcctc 901 agctatgcaa tagatgacaa acaaaagtat ccctacattg catcaatggg aatttatgtc 961 ttgaaaaaag atgttctttt agacattctg aagtcaaaat atgcacacct gcaagacttt 1021 ggatcagaaa ttctcccgag agctgtttta gagcataatg tgaaggcatg tgtcttcaca 1081 gaatattggg aggatattgg aacaatcaaa tcattttttg atgctaactt ggccctcacc 1141 gagcagcctc caaagttcga attttatgat ccaaaaactc ctttcttcac ctcacctcga 1201 tacttacctc cagcaagatt ggagaagtgc aagatcaaag atgcaataat ctccgatggc 1261 tgttccttta gtgaatgcac cattgagcat tctgtcattg gaatctcttc acgcgttagc 1321 atcgggtgtg aactcaagga taccatgatg atgggtgcag atcaatatga aactgaagaa 1381 gaaacttcaa agctattgtt tgaaggcaag gtcccaattg gtataggcga gaacacaaag 1441 ataaggaact gtatcatcga catgaatgct agaattggca ggaacgtgat cattgcaaac 1501 actcaggggg tccaagagtc tgatcaccct gaagagggat actacataag gtctggaatt 1561 gtggtgatcc tgaagaatgc aaccatcaag cacgggccga tcatataata gaagcttcag //Oryza sativaCDSAAK

1: T glucose-1- phospha... [gi: ] BLink, BLink, Domains, Links Domains, LOCUS T aa linear PLN 11-MAY-2000 DEFINITION glucose-1-phosphate adenylyltransferase (EC ) large chain - rice. ACCESSION T04156 VERSION T04156 GI: DBSOURCE pir: locus T04156; summary: #length 518 #molecular-weight #checksum 2032 ; genetic: #gene Sh2 #introns 69/3; 110/3; 167/3; 197/3; 226/3; 245/2; 276/3; 314/2; 338/ 3; 365/3; 394/3; 429/3; 465/2; 485/3 ; superfamily: glucose-1-phosphate adenylyltransferase ; PIR dates: 23-Apr-1999 #sequence_revision 23-Apr-1999 #text_change 11- May KEYWORDS glycogen/starch biosynthesis; nucleotidyltransferase. SOURCE Oryza sativa ORGANISM Oryza sativa Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; Ehrhartoideae; Oryzeae; Oryza. REFERENCE 1 (residues 1 to 518) AUTHORS Chen,M. and Bennetzen,J.L. TITLE Sequence composition and organization in the Sh2/A1-homologous region of rice JOURNAL Plant Mol. Biol. 32 (6), (1996) MEDLINE PUBMED FEATURES Location/Qualifiers source /organism="Oryza sativa" /mol_type="unassigned DNA" /db_xref="taxon:4530" Protein /product="glucose-1-phosphate adenylyltransferase large chain" /EC_number=" " ORIGIN 1 mqfmmpldtn acaqpmrrag egagterlme rlniggmtqe kalrkrcfgd gvtgtarcvf 61 tsdadrdtph lrtqssrkny adashvsavi lgggtgvqlf pltstratpa vpvggcyrli 121 dipmsncfns ginkifvmtq fnsaslnrhi hhtylgggin ftdgsvqvla atqmpdepag 181 wfqgtadair kfmwiledhy nqnniehvvi lcgdqlyrmn ymelvqkhvd dnaditisca 241 pidgsrasdy glvkfddsgr viqflekpeg adlesmkvdt sflsyaiddk qkypyiasmg 301 iyvlkkdvll dilkskyahl qdfgseilpr avlehnvkac vfteywedig tiksffdanl 361 alteqppkfe fydpktpfft sprylpparl ekckikdaii sdgcsfsect iehsvigiss 421 rvsigcelkd tmmmgadqye teeetskllf egkvpigige ntkirnciid mnarigrnvi 481 iantqgvqes dhpeegyyir sgivvilkna tikdgtviOryza sativa Protein