Amino Acid Sequences in V3 Loop Conformation Alex Cardenas, Bobby Arnold and Zeb Russo Loyola Marymount University Department of Biology BIO 398 11/02/11.

Slides:

Advertisements

Similar presentations

Changes In Protein Sequences Of the HIV-1 gp120 V3 Region In Non-Progressor Types Nicki S.Harmon Samantha M. Hurndon.

Advertisements

Genetic Similarities Between HIV-1 Viruses in the Onset of AIDS Isabel Gonzaga BIOL : Bioinformatics Laboratory Loyola Marymount University October.

Dual conformations for the HIV-1 gp120 V3 loop in complexes with different neutralizing Fabs RL Stanfield, E Cabezas, AC Satterthwait, EA Stura, AT Profy,

Investigating the Importance of non-coding transcripts.

BLOSUM Information Resources Algorithms in Computational Biology Spring 2006 Created by Itai Sharon.

5.4 Cladistics The ancestry of groups of species can be deduced by comparing their base or amino acid sequences.

Protein Structures.

Examination of Amino Acid Differences as a Means of Determining Functional Changes in HIV-1 Protein Sequences Chris Rhodes and Isaiah Castaneda Loyola.

Challenges in Modeling and Analyzing DNA Methylation Data Shili Lin Department of Statistics The Ohio State University.

SUPERVISED NEURAL NETWORKS FOR PROTEIN SEQUENCE ANALYSIS Lecture 11 Dr Lee Nung Kion Faculty of Cognitive Sciences and Human Development UNIMAS,

Analysis of HIV Evolution Bobak Seddighzadeh and Kristoffer Chin Department of Biology Loyola Marymount University Bio February 23, 2010.

Global network analysis of drug tolerance, mode of action and virulence in methicillin-resistant S. aureus Bobby Arnold Alex Cardenas Zeb Russo Loyola.

Multiple Alignment and Phylogenetic Trees Csc 487/687 Computing for Bioinformatics.

Unconserved Amino Acid Sequences in V3 Domain of gp120 Show No Significant Correlation to Altered Folding and Function Bobak Seddighzadeh Alex George.

STEPHANIE HINTZEN BIOL 471 SIV and HIV: Differences in Diversity and Divergence.

Re evaluating the Categorization of HIV Progression in Subjects Based on CD4 T cell Decline Rates Angela Garibaldi & Ryan Willhite Loyola Marymount University.

Construction of Substitution Matrices

A Mutational Investigation of an HIV Patient’s GP120 Glycoprotein and it’s Implications on CD4 Binding Salita Kaistha Usrinus College, Collegeville PA.

Global network analysis of drug tolerance, mode of action and virulence in methicillin-resistant S. aureus Bobby Arnold Alex Cardenas Zeb Russo Loyola.

Predicting the Onset of AIDS Robert Arnold, Alex Cardenas, Zeb Russo LMU Biology Department 10/5/2011.

Supporting Scientific Collaboration Online SCOPE Workshop at San Diego Supercomputer Center March 19-22, 2008.

Patterns of selection for or against amino acid change among different CD4 T-cell count progressor groups Michael Pina, Salomon Garcia Journal Club Presentation.

Diversity and Divergence in HIV-1 Viral Variants between patients with high CD4+ T Cell Variability and Patients with Rapid CD4+ T Cell Decline Kevin Paiz-Ramirez.

Mutations on the V3 loop of gp120 may predict progression to AIDS Derese Getnet, Dr. Rebecca Roberts, Structural Biology, Ursinus College, Collegeville.

Predicting the Onset of AIDS Robert Arnold, Alex Cardenas, Zeb Russo LMU Biology Department 10/5/2011.

Residue Sequence and Structure in the Re evaluation the Categorization of HIV Progression in Subjects Based on CD4 T cell Decline Rates Angela Garibaldi.

Homology modeling with SWISS-MODEL

Examining Subjects of HIV-1 With Possible Predominant Viral Strains Samantha Hurndon Isaiah Castaneda.

Role of V3 in HIV Entry and Neutralization Chloe Jones, Isabel Gonzaga, and Nicole Anguiano BIOL398: Bioinformatics Laboratory Loyola Marymount University.

Changes In Protein Sequences Of the HIV-1 gp120 V3 Region In Non-Progressor Types Nicki S.Harmon Samantha M. Hurndon LMU Department of Biology BIOL 368.

Construction of Substitution matrices

Examining the Genetic Similarity and Difference of the Three Progressor Groups at the First and Middle Visits Nicole Anguiano BIOL398: Bioinformatics Laboratory.

Examining Genetic Similarity and Difference of the Three Progressor Groups at the First and Middle Visits Nicole Anguiano Bioinformatics Laboratory Loyola.

V3 Loop Binding to CCR5 and CXCR4 of Rapid and Non Progressor HIV Patients in Baltimore MD BackgroundCCR5 and CXCR4 Receptor Rapid-progressor Patient 10.

Structure of V3-containing HIV-1 gp120 core Huang, C. C., Tang, M., Zhang, M. Y., Majeed, S., Montabana, E., Stanfield, R. L., Dimitrov, D. S., Korber,

Residue Sequence and Structure in the Re evaluation the Categorization of HIV Progression in Subjects Based on CD4 T cell Decline Rates Angela Garibaldi.

Examining Genetic Similarity and Difference of the Three Progressor Groups at the First and Middle Visits Nicole Anguiano BIOL398: Bioinformatics Laboratory.

PROTEIN IDENTIFIER IAN ROBERTS JOSEPH INFANTI NICOLE FERRARO.

Patterns of HIV-1 evolution in individuals with differing rates of CD4 T cell decline Markham RB, Wang WC, Weisstein AE, Wang Z, Munoz A, Templeton A,

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

Amino Acid Sequences in V3 Loop Conformation

The V3 Region Expresses More Diversity in Amino Acid Sequence in AIDS Diagnosed Patients than in Non-Trending and AIDS Progressing Patients HIV Structure.

Do HIV+ Rapid Progressors Show More Divergence than Non-Progressors?

Amino Acid Sequences in V3 Loop Conformation

Relationship between Genotype and Phenotype

Predicting the Onset of AIDS

Motif 1 Motif 3 Motif 6 Motif 2 Motif 5 Motif 4 Motif 4 Motif 1

Patterns of HIV-1 evolution in individuals with differing rates of CD4 T cell decline Markham RB, Wang WC, Weisstein AE, Wang Z, Munoz A, Templeton A,

Protein Structures.

Loyola Marymount University

LMU Department of Biology

GLUTAMINASE - Phylogenetic tree construction

Dual conformations for the HIV-1 gp120 V3 loop in complexes with different neutralizing Fabs RL Stanfield, E Cabezas, AC Satterthwait, EA Stura, AT Profy,

Regions of sequence homology across dominant clones in TLR7tg animals.

Predicting the Onset of AIDS

Loyola Marymount University

Loyola Marymount University

Amino Acid Sequences in V3 Loop Conformation

Patterns of HIV-1 evolution in individuals with differing rates of CD4 T cell decline Markham RB, Wang WC, Weisstein AE, Wang Z, Munoz A, Templeton A,

Biology Standards.

Yusuke Nakasone, Kazunori Zikihara, Satoru Tokutomi, Masahide Terazima

Predicting the Onset of AIDS

Residue Sequence and Structure in the Re evaluation the Categorization of HIV Progression in Subjects Based on CD4 T cell Decline Rates Angela Garibaldi.

Amino acid sequence alignment of beetle luciferases.

Common Errors in Student Annotation Submissions contributions from Paul Lee, David Xiong, Thomas Quisenberry Annotating multiple genes at the same locus.

Chloe Jones, Isabel Gonzaga, and Nicole Anguiano

Loyola Marymount University

Selectivity-determining regions

Alignment of the Amino Acid Sequences of NCS and Other PR10/Bet v1 Proteins from Various Plant Species.Deduced amino acid sequences were aligned using.

Presentation transcript:

Amino Acid Sequences in V3 Loop Conformation Alex Cardenas, Bobby Arnold and Zeb Russo Loyola Marymount University Department of Biology BIO /02/11

Outline CD4 T cell count is a trait in developing AIDs ( >200 safe, <200 AIDs). Differing CD4 T cell count is correlated with conservation in amino acid sequences. Multiple sequence alignments (for V3 region) were run against controlled subjects and AIDs subjects. Results obtained from multiple sequence were observed and analyzed. Discussion and thoughts of our findings are shared.

Outline CD4 T cell count is a trait in developing AIDs ( >200 safe, <200 AIDs). Differing CD4 T cell count is correlated with conservation in amino acid sequences. Multiple sequence alignments (for V3 region) were run against controlled subjects and AIDs subjects. Results obtained from multiple sequence were observed and analyzed. Discussion and thoughts of our findings are shared.

CD4 T cell count is an trait in developing AIDs ( >200 safe, <200 AIDs) Observations led us to conclude that CD4 T cell counts were crucial in developing AIDs. Rapid Progressors – 1, 3, 4, 10, 11, 15. Controls – Moderate progressor – 6. – Non Progessor – 13.

Outline CD4 T cell count is a trait in developing AIDs ( >200 safe, <200 AIDs). Differing CD4 T cell count is correlated with conservation in amino acid sequences. Multiple sequence alignments (for V3 region) were run against controlled subjects and AIDs subjects. Results obtained from multiple sequence were observed and analyzed. Discussion and thoughts of our findings are shared.

CD4 T cell count and relationship to V3 loop amino acid sequence We were interested in the amino acid sequences of AIDs subjects. Our question – Is there a conserved region in the V3 loop sequence that led the subject to develop AIDs?