J. Biol. Chem. 266, pp. 8302-8311,1991 Purification and Partial Sequence Analysis of pp185, the Major Cellular Substrate of the Insulin Receptor Tyrosine.

Slides:



Advertisements
Similar presentations
ABE Summer Workshop 2005 Southern & Western Blotting.
Advertisements

A Novel Multigene Family May Encode Odorant Receptors: A Molecular Basis for Odor Recognition Linda Buck and Richard Axel Published in Cell, Volume 65,
BRIAN PHAN DR. JANE ISHMAEL DEPARTMENT OF PHARMACEUTICAL SCIENCES SUMMER 2010 Characterization of LC8 Interaction with NR1 subunit of NMDA Receptors.
Signaling and the Signal Transduction Cascade. Question?????? External Stimulus Inside cell Nucleus, Gene transcription Other cellular effects.
Regulation of protein phosphorylation by insulin/IGF-1 Yang,Yu-Ying Tseng, Yu-Hua C.Ronald Kahn.
MCB 720: Molecular Biology
MCB 7200: Molecular Biology
Immunoprecipitation JS Yu 2002/8/14 Rat brain (or HeLa cells) *weighting *homogenization (1 gm tissue/3 ml Homo buffer) *centrifugation (12000~15000 rpm,
Magic Lysis Buffer Improves the Efficiency of Immunoprecipitation-LC/MS/MS (IP-MS) with Less Non-Specific Interactions and Stronger Retention of Binding.
Construction, Transformation, and Prokaryote Expression of a Fused GFP and Mutant Human IL-13 Gene Sequence Lindsay Venditti, Department of Biological.
-The methods section of the course covers chapters 21 and 22, not chapters 20 and 21 -Paper discussion on Tuesday - assignment due at the start of class.
Library screening Heterologous and homologous gene probes Differential screening Expression library screening.
Proteomics The science of proteomics Applications of proteomics Proteomic methods a. protein purification b. protein sequencing c. mass spectrometry.
Group 4 Data Diane Meas The 3 A-Michaels (get it??) 3 amigos… a-michaels….
Cell Signaling. Local Signaling Paracrine Paracrine Synaptic Synaptic.
Lecturer: David. * Reverse transcription PCR * Used to detect RNA levels * RNA is converted to cDNA by reverse transcriptase * Then it is amplified.
Biotechnology and Genetic Engineering PBIO 450/550 Gene libraries cDNA libraries Library screening.
Figure S1 A MVNFVSAGLFRCLPVSCPEDLLVEELVDGLLSLEEELKDKEEEEAVLDGL LSLEEESRGRLRRGPPGEKAPPRGETHRDRQRRAEEKRKRKKEREKE EEKQTAEYLKRKEEEKARRRRRAEKKAADVARRKQEEQERRERKWRQ.
Insulin and glucose uptake in muscle and adipose tissue
supplementary Fig. 1 Anti-HSP70 Ab Anti-SHP2 Ab
Immunoprecipitation JS Yu 2002/8/14
Cell Physiol Biochem 2013;32: DOI: /
Briefly explain the location of the cellular receptor and the mechanism of action of steroid hormones. Distinguish between synaptic, paracrine, and endocrine.
1.2 A R2 B 3a 3b c (R4) 0.6 R4 R R3 R M R1.
Volume 119, Issue 3, Pages (September 2000)
Volume 32, Issue 1, Pages (October 2008)
Discrete Proteolytic Intermediates in the MHC Class I Antigen Processing Pathway and MHC I–Dependent Peptide Trimming in the ER  Pedro Paz, Nathalie Brouwenstijn,
You have identified a novel cytoplasmic protein
Insulin Beef Drugbank ID : DB09456 Molecular Weight (Daltons) :5733.5
Biotechnology and Genetic Engineering PBIO 4500/5500
Volume 7, Issue 8, Pages (August 2000)
Volume 86, Issue 6, Pages (September 1996)
Volume 89, Issue 5, Pages (May 1997)
Volume 6, Issue 3, Pages (September 2007)
IRS1-Independent Defects Define Major Nodes of Insulin Resistance
Interleukin-18 Binding Protein
Human Papilloma Virus E6 and E7 Proteins Support DNA Replication of Adenoviruses Deleted for the E1A and E1B Genes  Dirk S. Steinwaerder, Cheryl A. Carlson,
The Mammalian Brain rsec6/8 Complex
Volume 78, Issue 2, Pages (July 2010)
Volume 79, Issue 8, Pages (April 2011)
A Novel MAP Kinase Regulates Flagellar Length in Chlamydomonas
Cell Communication (Signaling) Part 3
Volume 93, Issue 7, Pages (June 1998)
GRASP65, a Protein Involved in the Stacking of Golgi Cisternae
Volume 7, Issue 8, Pages (August 2000)
Yang Shen, Monica Naujokas, Morag Park, Keith Ireton  Cell 
FRIP, a Hematopoietic Cell-Specific rasGAP-Interacting Protein Phosphorylated in Response to Cytokine Stimulation  Keats Nelms, Andrew L. Snow, Jane Hu-Li,
Yuji Yamanashi, David Baltimore  Cell 
Volume 45, Issue 6, Pages (March 2012)
Volume 93, Issue 5, Pages (May 1998)
Volume 13, Issue 9, Pages (December 2015)
Volume 13, Issue 2, Pages R50-R52 (January 2003)
Volume 87, Issue 4, Pages (November 1996)
Volume 7, Issue 2, Pages (February 2001)
Discrete Proteolytic Intermediates in the MHC Class I Antigen Processing Pathway and MHC I–Dependent Peptide Trimming in the ER  Pedro Paz, Nathalie Brouwenstijn,
Localization of the Iff8 extended protein.
Ganglioside Modulates Ligand Binding to the Epidermal Growth Factor Receptor  Xiaoqi Wang, Zakia Rahman, Ping Sun, Emmanuelle Meuillet, David George, Eric.
BLNK Required for Coupling Syk to PLCγ2 and Rac1-JNK in B Cells
Christopher Belham, Michael J. Comb, Joseph Avruch  Current Biology 
Cell Communication (Signaling) Part 3
Volume 9, Issue 17, Pages S1-986 (September 1999)
Human Pre-mRNA Cleavage Factor Im Is Related to Spliceosomal SR Proteins and Can Be Reconstituted In Vitro from Recombinant Subunits  Ursula Rüegsegger,
Volume 104, Issue 4, Pages (February 2001)
Interleukin-18 Binding Protein
Volume 4, Issue 5, Pages (May 1996)
Inducible liver-specific insulin receptor knockout (iLIRKO) shows insulin resistance in the liver and extrahepatic tissues. Inducible liver-specific insulin.
Volume 20, Issue 5, Pages (May 1998)
Volume 92, Issue 1, Pages (January 1998)
Volume 15, Issue 4, Pages (October 2001)
Alain Verreault, Paul D. Kaufman, Ryuji Kobayashi, Bruce Stillman 
Presentation transcript:

J. Biol. Chem. 266, pp ,1991 Purification and Partial Sequence Analysis of pp185, the Major Cellular Substrate of the Insulin Receptor Tyrosine Kinase* Paul L. Rothenberg, William S. Lane, Avraham Karasik, Jonathan Backer, Morris White, & C. Ronald Kahn The Department of Medicine, Brigham and Women’s Hospital, Harvard Medical School, Boston, MA pp185 INR(  ) FaO hepatoma cells +/- insulin (1  M), 1 min (1) SDS(100 o C) extraction/TCA ppt or (2) Liquid N 2 quick-freezing Triton X-100 extraction IP by anti-PY antibody SDS-PAGE Western blot by anti-PY antibody

Rats +/- insulin (from portal vein) 1 min or various time points Tissue removed SDS/TCA extraction IP by anti-PY antibody SDS-PAGE Western blot by anti-PY antibody TCA ppt/washed by organic solvent/ lypholized/0.1 M NaOH solubilized/ filtered with 0.45  M membrane Liver Fat pads pp185 INR(  ) pp185 INR(  )

Rats insulin infusion (from portal vein) (0.5 min at 1 ml/min) Liver removed SDS/TCA extraction IP by anti-PY antibody SDS-PAGE Western blot by anti-PY antibody Half maximum stimulation ~1-5 x M insulin

Rats insulin infusion (from portal vein) (0.5 min at 1 ml/min) Liver removed SDS/TCA extraction IP by anti-PY antibody Eluted by pNPP Sup. + ppt. SDS-PAGE Western blot by anti-PY antibody & silver stained

50 Rats (starvation for 2-3 days) +/- insulin infusion (from portal vein) (0.5 min at 1 ml/min) Liver removed SDS/TCA extraction IP by anti-PY antibody Eluted by pNPP Sup. + ppt. SDS-PAGE Transferred to NC membrane & trypsin digested RP C18 HPLC Amino acid sequencer + - insulin

CPS: carbamyl phosphate synthase as major contaminant in pp185 fraction

Production of anti-peptide 80 Ab Rats insulin infusion (from portal vein) (0.5 min at 1 ml/min) Liver removed SDS/TCA extraction IP by anti-PY or anti-pep 80 antibody SDS-PAGE Western blot by anti-PY or anti-pep 80 antibody IP: aPY aPY aPep80 aPep80 WB: aPY aPep80 aPep80 aPY (insulin)

Nature Jul 4;352(6330):73-7. Structure of the insulin receptor substrate IRS-1 defines a unique signal transduction protein. Sun XJ, Rothenberg P, Kahn CR, Backer JM, Araki E, Wilden PA, Cahill DA, Goldstein BJ, White MF. Joslin Diabetes Center, Department of Medicine, Harvard Medical School, Boston, Massachusetts, USA IRS-1 cloning strategy: (1)Two cDNA libraries (2)Screened by 32 P-oligonucleotide probes made from peptide 80 and 138 (3)Picked up positive clones and sequence determination (C18, C19 & P2-2) (4)Screened further by probes derived from C18 & P2-2 (14 clones were obtained) (5)Sequencing and overlapping DNA sequences of 14 clones

IRS-1 cDNA: (1) Hydrophilic protein, 131 kDa (2) 9 tryptic peptides in DNA sequence (3) No SH2/SH3 domains (4) Contain ATP-binding domain (GXGXXG) (5) No protein kinase activity (6) mRNA 9.5 kb

6 YMXM motif 3 YXXM motif 1 EYYE motif Synthetic YMXM-containing peptide can be phosphorylated by purified INSR, Km~50  M

CHO/IR cells CHO/IRS-1 CHO/Neo metabolic 32 P-labelling +/- insulin (100 nM, 1 min) cell extractes IP by PY-Ab SDS-PAGE/autoradiography IRS-1 expressed in CHO cells as 185 kDa PY-containing protein

CHO/IR or CHO/IR F960 or CHO/IR D960 cells metabolic 32 P-labelling +/- insulin (100 nM, 1 min) cell extractes IP by PY-Ab or IRS-1 Ab SDS-PAGE/autoradiography cut out 32 P-labelled pp185 and IRS-1 Phosphoamino acid analysis Y960: the aa required for insulin signaling

CHO/IR cells +/- insulin (100 nM, 10 min) cell extractes IP by IR Ab or PY Ab or IRS-1 Ab PI3 kinase assay in the IPP

Role of IRS-1 in insulin-mediated signal transduction