Cool BaRC Web Tools Prat Thiru. BaRC Web Tools We have.

Slides:



Advertisements
Similar presentations
SRI International Bioinformatics Comparative Analysis Q
Advertisements

© Wiley Publishing All Rights Reserved. Using Nucleotide Sequence Databases.
Beyond PubMed and BLAST: Exploring NCBI tools and databases Kate Bronstad David Flynn Alumni Medical Library.
Basic Genomic Characteristic  AIM: to collect as much general information as possible about your gene: Nucleotide sequence Databases ○ NCBI GenBank ○
The design, construction and use of software tools to generate, store, annotate, access and analyse data and information relating to Molecular Biology.
Sequence Analysis MUPGRET June workshops. Today What can you do with the sequence? What can you do with the ESTs? The case of SNP and Indel.
Copyright OpenHelix. No use or reproduction without express written consent1 Organization of genomic data… Genome backbone: base position number sequence.
Kate Milova MolGen retreat March 24, Microarray experiments: Database and Analysis Tools. Kate Milova cDNA Microarray Facility March 24, 2005.
UCSC Genome Browser Tutorial
Biological Databases Chi-Cheng Lin, Ph.D. Associate Professor Department of Computer Science Winona State University – Rochester Center
Kate Milova MolGen retreat March 24, Microarray experiments. Database and Analysis Tools. Kate Milova cDNA Microarray Facility March 24, 2005.
Genomic Database - Ensembl Ka-Lok Ng Department of Bioinformatics Asia University.
Kate Milova MolGen retreat March 24, Microarray experiments. Database and Analysis Tools. Kate Milova cDNA Microarray Facility March 24, 2005.
Algorithm Animation for Bioinformatics Algorithms.
UCSC Known Genes Version 3 Take 10. Overall Pipeline Get alignments etc. from database Remove antibody fragments Clean alignments, project to genome Cluster.
Kate Milova MolGen retreat March 24, Microarray experiments. Database and Analysis Tools. Kate Milova cDNA Microarray Facility March 24, 2005.
Scaffold Download free viewer:
Doug Brutlag 2011 Genome Databases Doug Brutlag Professor Emeritus of Biochemistry & Medicine Stanford University School of Medicine Genomics, Bioinformatics.
Login: BITseminar Pass: BITseminar2011 Login: BITseminar Pass: BITseminar2011.
The Genome Genome Browser Training Materials developed by: Warren C. Lathe, Ph.D. and Mary Mangan, Ph.D. Part 1.
Genome Informatics 2005 ~ 220 participants 1 keynote speaker: David Haussler 47 talks 121 posters.
GENOME-CENTRIC DATABASES Daniel Svozil. NCBI Gene Search for DUT gene in human.
Doug Raiford Lesson 3.  More and more sequence data is being generated every day  Useless if not made available to other researchers.
Copyright OpenHelix. No use or reproduction without express written consent 2 Overview of Genome Browsers Materials prepared by Warren C. Lathe, Ph.D.
is accessible at: The following pages are a schematic representation of how to navigate through ALE-HSA21.
Use cases for Tools at the Bovine Genome Database Apollo and Bovine QTL viewer.
Copyright OpenHelix. No use or reproduction without express written consent1.
UCSC Genome Browser 1. The Progress 2 Database and Tool Explosion : 230 databases and tools 1996 : first annual compilation of databases and tools.
Regulatory Genomics Lab Saurabh Sinha Regulatory Genomics Lab v1 | Saurabh Sinha1 Powerpoint by Casey Hanson.
NCBI’s Genome Annotation: Overview Incremental processing Re-annotation ( batch ) Post-annotation review Case studies NOTE: limiting discussion to annotation.
COURSE OF BIOINFORMATICS Exam_31/01/2014 A.
Why do we need good quality annotations? Pankaj Jaiswal Oregon State University Gene Annotation Workshop July 31, 2010 ASPB Plant Biology 2010 Montreal,
ANALYSIS AND VISUALIZATION OF SINGLE COPY ORTHOLOGS IN ARABIDOPSIS, LETTUCE, SUNFLOWER AND OTHER PLANT SPECIES. Alexander Kozik and Richard W. Michelmore.
Part I: Identifying sequences with … Speaker : S. Gaj Date
Organizing information in the post-genomic era The rise of bioinformatics.
1 of 38 Data Mining in Ensembl with BioMart. 2 of 38 Simple Text-based Search Engine.
UBio Training Courses Micro-RNA web tools Gonzalo
BIOINFORMATIK I UEBUNG 2 mRNA processing.
Professional Development Course 1 – Molecular Medicine Genome Biology June 12, 2012 Ansuman Chattopadhyay, PhD Head, Molecular Biology Information Services.
Web Databases for Drosophila Introduction to FlyBase and Ensembl Database Wilson Leung6/06.
Alastair Kerr, Ph.D. WTCCB Bioinformatics Core An introduction to DNA and Protein Sequence Databases.
Biological databases Exercises. Discovery of distinct sequence databases using ensembl.
Building WormBase database(s). SAB 2008 Wellcome Trust Sanger Insitute Cold Spring Harbor Laboratory California Institute of Technology ● RNAi ● Microarray.
Web Databases for Drosophila An introduction to web tools, databases and NCBI BLAST Wilson Leung08/2015.
Regulatory Genomics Lab Saurabh Sinha Regulatory Genomics | Saurabh Sinha | PowerPoint by Casey Hanson.
Data Mining in Ensembl with BioMart Giulietta Spudich.
A collaborative tool for sequence annotation. Contact:
Tools in Bioinformatics Genome Browsers. Retrieving genomic information Previous lesson(s): annotation-based perspective of search/data Today: genomic-based.
How can we find genes? Search for them Look them up.
EBI is an Outstation of the European Molecular Biology Laboratory. Gautier Koscielny VectorBase Meeting 08 Feburary 2012, EBI VectorBase Text Search Engine.
EBI is an Outstation of the European Molecular Biology Laboratory. UniProtKB Sandra Orchard.
Bioinformatics Workshops 1 & 2 1. use of public database/search sites - range of data and access methods - interpretation of search results - understanding.
Tools in Bioinformatics Genome Browsers. Retrieving genomic information Previous lesson(s): annotation-based perspective of search/data Today: genomic-based.
Accessing and visualizing genomics data
What is BLAST? Basic BLAST search What is BLAST?
Genomes at NCBI. Database and Tool Explosion : 230 databases and tools 1996 : first annual compilation of databases and tools lists 57 databases.
Work Presentation Novel RNA genes in A. thaliana Gaurav Moghe Oct, 2008-Nov, 2008.
Visualization of genomic data Genome browsers. UCSC browser Ensembl browser Others ? Survey.
COURSE OF BIOINFORMATICS Exam_30/01/2014 A.
The Bovine Genome Database Abstract The Bovine Genome Database (BGD, facilitates the integration of bovine genomic data. BGD is.
Biocomputational Languages December 1, 2011 Greg Antell & Khoa Nguyen.
GeneConnect Use Cases and Design August 3, GeneConnect Database IDs are linked by Direct Annotation, Inferred Annotation, or Sequence Alignment.
Web Databases for Drosophila
What is BLAST? Basic BLAST search What is BLAST?
Figure 1. Number of CCDS IDs and genes represented in the human (A) and mouse (B) CCDS releases. The X-axis indicates the year in which a CCDS dataset.
University of Pittsburgh
Visualization of genomic data
Ensembl Genome Repository.
Protein domains Jasmin sutkovic
Problems from last section
Presentation transcript:

Cool BaRC Web Tools Prat Thiru

BaRC Web Tools We have tools for: General Analysis and File Utilities Genomics EntrezGene/RefSeq/UniGene/SGD/GenBank annotation Homology (Orthology) Converting IDs between databases Functional Analysis Visualization

General Analysis and File Utilities Venn Diagram Generator Show the number of items shared and unique between two sets

General Analysis and File Utilities Compare Two Lists Find what is common and unique between two lists NM_ NM_ NM_ NM_ XM_ NR_ XM_ NR_ NM_

General Analysis and File Utilities Redundant List Analysis Count the number of occurrences in a list NM_ NM_ XM_ XM_ NR_ NM_

General Analysis and File Utilities Submatrix Selector Select specific rows and columns in a file

Genomics Genomic Sequence Extractor Retrieve sequence up/down stream for a list of genomic location(s)

Genomics RefSeq Regulatory Extractor Retrieve regions around transcription start or end site

Genomics Merge Overlapping Genome Regions Collapse overlapping regions into a single region

EntrezGene/RefSeq/UniGene/SGD/GenBank annotation Entrez Gene IDs  info Get information for a list of Entrez Gene IDs

EntrezGene/RefSeq/UniGene/SGD/GenBank annotation Extract UTRs and/or CDS regions from GenBank sequences Retrieve UTRs/CDS from GenBank flat file

Homology (Orthology) Find orthologous Ensembl IDs

Converting IDs between Databases Entrez Gene IDs  Ensembl IDs Convert gene ids from Entrez to Ensembl 

Functional Analysis Map Genes to Pathways Determine which pathway genes might be involved from different databases.

Functional Analysis Identify over-represented GO terms in a gene set Find out which GO categories are over-represented in the GO terms

Functional Analysis Walk up GO ontologies to get more general "induced" terms Find more general GO terms

Functional Analysis Tabulate the number of codons in sequence data Determine codon usage in a sequence

Visualization Protein Sequence Visualization Tool Color codes amino acids

Visualization Sequence Word Viewer Display occurrences of a motif Seq 55 MTKVYANSIQQHLCLDSLTGPVRSVLTQGTTAEKERVVDRIALLERCLDP SNSLPPVRSVLTQGTTAEKVQLVVSCLGVVCSIICLALGIAAAAVTAKRL VAVAVATILAVALLVVAGLLFSGVLCSPVSVLAASLFFGVGAFLLGGALV GGVLTTEAVTRERLHRSQTLMWNNLCCKTAEVEQKISTASANAKSNDKTR KLGE Seq 200 MECVKQLCRNHLCLDSLTGPVRSVLTQGTTAEKVQLVVSCLGVVCSIICL ALGIAAAAVGVSCSGFAIGLGVIAILLGIVLFAISALDVLEDHGLVGAAS LFFGVGAFLLGGALVGGCPFKLPCKSSPANEPTVQFFKGKNGSADKVILV TQ

TargetScan Find predicted targets of miRNA

Need a tool? Let us know!