Harpreet. K. Dhiman 05/22/06. Garp-2 expression in HEK293S cells A total of 50 plates used. 1.25* 10 9 cells were used to express Garp-2 protein. Already.

Slides:

Advertisements

Similar presentations

Expression, Purification and Isolation of the MinE protein By Arsalan Wasim and Nicholas Wong.

Advertisements

Supplementary Methods TEM (transmission electron microscopy). TEM analysis were performed on EF-TEM LEO 912AB (Carl Zeiss Inc., Germany, Korea Basic Science.

It's usually difficult to identify a protein of interest in a Commassie Blue-stained gel of cell extracts Coomassie Blue-stained gel MW stds. Cell extracts.

1 Human metabotropic glutamate receptor 6: Expression and purification Kalyan Tirupula Graduate Student JKS Lab, UPitt.

1 Lab Report: GARP 2 & Stains-All studies Fernanda Balem Department of Pharmacology 10/17/05.

PreimmuneMonoclonalanti-Aur-AAffinity Purified anti-Aur-A Blot: retic lysate translation product oocyte extract retic lysate translation.

Figure S1 A MVNFVSAGLFRCLPVSCPEDLLVEELVDGLLSLEEELKDKEEEEAVLDGL LSLEEESRGRLRRGPPGEKAPPRGETHRDRQRRAEEKRKRKKEREKE EEKQTAEYLKRKEEEKARRRRRAEKKAADVARRKQEEQERRERKWRQ.

Figure S1. Production of recombinant NS1 protein

RASSF2DSARAH-GF (b) MST1-F (a) M F G 70 kD a 55 kD b 36 kD

1&3: hGH-sc(Fc)2 2&4: hGH-Fc anti-Fc anti-hGH

Development of Med28 Specific Monoclonal Antibodies

Fig. 4. Expressional profiles of apolipoproteins in HDL

Volume 63, Issue 2, Pages (February 2003)

by Yoko Otake, Sridharan Soundararajan, Tapas K. Sengupta, Ebenezer A

Epitope mapping of ADAMTS13 autoantibodies in acquired thrombotic thrombocytopenic purpura by Christoph Klaus, Barbara Plaimauer, Jan-Dirk Studt, Friedrich.

Induction of apoptosis by CDIP expression.

ADAP interactions with talin and kindlin promote platelet integrin αIIbβ3 activation and stable fibrinogen binding by Ana Kasirer-Friede, Jian Kang, Bryan.

SkMLCK physically interacts with and phosphorylates MEF2C in vivo and in vitro. skMLCK physically interacts with and phosphorylates MEF2C in vivo and in.

The RD1-encoded antigen Rv3872 of Mycobacterium tuberculosis as a potential candidate for serodiagnosis of tuberculosis P. Mukherjee, M. Dutta, P. Datta,

Cloning, expression, and functional characterization of the von Willebrand factor–cleaving protease (ADAMTS13)‏ by Barbara Plaimauer, Klaus Zimmermann,

Hours after rec PR-Set7 release Ladder kDa 15 PR-Set7 Coomassie

Specific Lysis of Melanoma Cells by Receptor Grafted T Cells is Enhanced by Anti- Idiotypic Monoclonal Antibodies Directed to the scFv Domain of the Receptor

Autoimmunity to Munc-18 in Rasmussen's Encephalitis

Reduced copurification of selected co-opted host proteins with the viral replicase from yeast coexpressing WW-domain protein. Reduced copurification of.

Gene expression and immunologic consequence of SPAN-Xb in myeloma and other hematologic malignancies by Zhiqing Wang, Yana Zhang, Haichao Liu, Emanuela.

TEV protease elution from cellulose is specific and provides highly purified target protein. TEV protease elution from cellulose is specific and provides.

Volume 5, Issue 2, Pages (August 1996)

The ΔrlmA mutant strain has impaired CWI pathway activation.

Figure 2 M1 and M23 AQP4 isoforms compared by freeze-fracture electron microscopic and Western blot analyses M1 and M23 AQP4 isoforms compared by freeze-fracture.

Dimers Probe the Assembly Status of Multimeric Membrane Proteins

Decreased Growth Inhibitory Responses of Squamous Carcinoma Cells to Interferon-γ Involve Failure to Recruit cki Proteins into cdk2 Complexes Beth L.

M.Brandon Parrott, Michael A. Barry Molecular Therapy

Volume 11, Issue 1, Pages (January 2003)

Identification of novel IgGs in alpaca serum.

MED12 interacts with TDRD3 in a CARM1-dependent fashion.

Purification of chromogranin B from over-expressing insect sf9 cells.

Yang Shen, Monica Naujokas, Morag Park, Keith Ireton Cell

Fig. 4. Identification of GRP78 as the target antigen of NMO-rAbs ON and ON Identification of GRP78 as the target antigen of NMO-rAbs.

Negative Control of p53 by Sir2α Promotes Cell Survival under Stress

The PbGAPDH G6 fragment interacts with recombinant CD68.

Expression of SYCE2 inhibits the interaction of HP1α with H3K9me3.

Volume 16, Issue 5, Pages (May 2008)

Cyclin G Recruits PP2A to Dephosphorylate Mdm2

Md Nasimuzzaman, Danielle Lynn, Johannes CM van der Loo, Punam Malik

S-Affs do not inhibit SUMO conjugation or deconjugation.

Yohei Mukoyama, Shuxia Zhou, Yoshiki Miyachi, Norihisa Matsuyoshi

Three different mimotope peptides mimic different domains of the the P berghei GAPDH molecule. Three different mimotope peptides mimic different domains.

BRCA1 Is a Histone-H2A-Specific Ubiquitin Ligase

Volume 13, Issue 3, Pages (September 2000)

Titration of antisera against the amount of extract loaded on Western blots. Titration of antisera against the amount of extract loaded on Western blots.

Western blot analysis of histone H1.X.

Crim1 colocalizes with integrin and activates the integrin-FAK-ERK signaling pathway. Crim1 colocalizes with integrin and activates the integrin-FAK-ERK.

Interaction of periostin with ECM molecules.

Volume 60, Issue 6, Pages (December 2001)

V-2A-GFP/V-2A-coexpressing Mycobacterium tuberculosis antigens and GFP

Fig. 4. Tetracycline-regulated expression of ClC-5 in the HEK293 cells stably expressing gastric H+,K+-ATPase.(A) Alignments of rat ClC-5, human ClC-5,

Reconstitution of the Transcription Factor TFIIH

Volume 9, Issue 1, Pages (January 2002)

Downregulation of Rab7 expression with RNAi caused accumulation of late autophagic vacuoles. Downregulation of Rab7 expression with RNAi caused accumulation.

Western blotting for GluR1.

Effect of other nucleoside analogues on p38 MAPK phosphorylation levels. Effect of other nucleoside analogues on p38 MAPK phosphorylation levels. A, MM.1S.

Isolation of stable XPAKD and XPCKD HeLa clones.

Identification of the recombinant structural proteins expressed in recombinant baculovirus-infected Sf9 cells by immunofluorescence assay with rabbit anti-FMDV.

ODC protein expression in paired benign and cancer tissue obtained from patients with PCA. The protein expression was measured by immunoblot analysis in.

Volume 41, Issue 4, Pages (February 2011)

RA-9 induces G2–M cell-cycle arrest and caspase-mediated apoptosis in ovarian cancer cells. RA-9 induces G2–M cell-cycle arrest and caspase-mediated apoptosis.

Stable Cx43 expression in infected Cx43−/− cells and phosphorylation of Cx43. Stable Cx43 expression in infected Cx43−/− cells and phosphorylation of Cx43.

Volume 7, Issue 1, Pages (January 2001)

Expression of MtrE by wild-type and mtr120 mutant strains.

Volume 113, Issue 4, Pages (May 2003)

Presentation transcript:

Harpreet. K. Dhiman 05/22/06

Garp-2 expression in HEK293S cells A total of 50 plates used. 1.25* 10 9 cells were used to express Garp-2 protein. Already screened stable cell line clone was expanded. The cells were induced by using tetracycline (2  g/ml) and sodium Butyrate (5mM) followed by harvesting of cells after 2 days. Purification using strep-Tactin sepharose gravity flow column.

Garp-2 expression in Tetracycline inducible Cos-1 cells A total of 50 plates used. 1.25* 10 9 cells were used to express Garp-2 protein. DEAE-Dextran method was used for transfection. Cells were harvested after 3 days. Purification using strep-Tactin sepharose gravity flow column.

Garp-2 expression in baculovirus expression system. 1.25* 10 9 cells were used to express Garp-2 protein. MOI 8 (multiplicity of infection)was used to infect the sf-9 insect cells in exponential phase Cells were harvested after 3 days. Purification using strep-Tactin sepharose gravity flow column.

Western blot of Garp-2 expression from three systems using equivalent amount of cells. Garp-2 antibody was made against a peptide from c-terminus of Garp-2 ( ). From: Korschen, H. G., M. Beyermann, et al. (1999). "Interaction of glutamic-acid-rich proteins with the cGMP signalling pathway in rod photoreceptors." Nature 400(6746): Figure 1: Western blot analysis of StrepTag-Garp-2 protein expression from Bac-Bac baculovirus expression system by sf-9 cells, transient transfection by Cos-1 cells and stable HEK293S cells. To detect the protein an antibody against a peptide from c- terminus of Garp-2 ( ) was used. In the first sf-9 cells lane, purified recombinant Garp-2 was diluted 1:100 and 10  l was loaded. In the next lane, 10  l Garp-2 protein from Cos-1 cells, followed by 40  l protein from HEK-293S cells was loaded directly without dilution.

Stains-All gel of Garp-2 expression from three systems using equivalent amount of cells. Figure 1: The Stains-All gel of purified recombinant Garp-2 protein HEK293S, Cos-1 and sf-9 cells. In the first and second lane, 40µl of purified recombinant Garp-2 from HEK293S and Cos-1 cells was loaded followed by 5 µl Grap-2 from sf-9 cell.

Western blot of purified Garp-2 expression from three systems using equivalent amount of cells. Garp-2 antibody used for western blot was obtained from Germany. The antibody was made against a peptide from c-terminus of Garp-2 ( ). Source:From: Korschen, H. G., M. Beyermann, et al. (1999). "Interaction of glutamic-acid-rich proteins with the cGMP signalling pathway in rod photoreceptors." Nature 400(6746): M Cos-1 10ulSf-9 ( 1:10) 10ul Sf-9 ( 1:50) 10ul Sf-9 ( 1:100) 10ul Sf-9 ( 1:100) 20ul Sf-9 ( 1:100) 30ulSf-9 ( 1:50) 20ul HEK 40ulCos-1 5ul

Coomassie stained PVDF membrane after transfer of Garp-2 protein from gel to membrane. M Sf-9 1ulSf-9 2ul Sf-9 4ul M HEK 10ul Cos-1 10ul HEK 10ulCos-1 10ul

Western blot of purified Garp-2 expression from three systems using equivalent amount of cells. M Cos-1 10ul Sf-9 ( 1:10) 10ul Sf-9 ( 1:50) 10ulSf-9 ( 1:100) 10ulSf-9 ( 1:100) 20ulSf-9 ( 1:100) 30ulSf-9 ( 1:50) 20ul HEK 40ul Cos-1 5ul Sterp-tactin HRP conjugate from IBA GmbH company was used for detection of sterp- tagged protein.

Comparison M Cos-1 10ul Sf-9 ( 1:10) 10ul Sf-9 ( 1:50) 10ul Sf-9 ( 1:100) 10ul Sf-9 ( 1:100) 20ul Sf-9 ( 1:100) 30ul Sf-9 ( 1:50) 20ul HEK 40ul Cos-1 5ul M Cos-1 10ulSf-9 ( 1:10) 10ul Sf-9 ( 1:50) 10ulSf-9 ( 1:100) 10ulSf-9 ( 1:100) 20ulSf-9 ( 1:100) 30ulSf-9 ( 1:50) 20ul HEK 40ulCos-1 5ul

Thanks