Tissue homogenate with precipitation Tissue homogenate without precipitation Cy5: PP2A 0.1 U Cy5: PP2A 1U Cy3: PP2A 0.1 U Cy3: PP2A 1U Cy5: PP2A 1U Supplementary.

Slides:

Advertisements

Similar presentations

Probability Chances Are… You can do it! Activity #3.

Advertisements

Fraction Finder Can you identify the fractions?. What fraction of this shape is yellow?

1/8 AND, OR and NOT b How many boys? b How many girls? b How many blue? b How many red?

FRACTIONS LEARNING AIMS Students will: answer the question, ‘what is a fraction?’ identify the names for the top (numerator) and bottom (denominator) of.

© 2011 Brooks/Cole, Cengage Learning6 | 1. © 2011 Brooks/Cole, Cengage Learning6 | 2.

May 12-15, 2011 (red) May 6-11, 2011 (light red) Permanent Water (blue)

P247. Figure 9-1 p248 Figure 9-2 p251 p251 Figure 9-3 p253.

Mrs. Smith’s 7th Grade Reading Blue Class Mrs. Smith’s 7th Grade Reading Blue Class Mrs. Smith’s 7th Grade Reading Blue Class.

$100 $200 $300 $400 $500 $100 $200 $300 $400 $500 $100 $200 $300 $400 $500 $100 $200 $300 $400 $500 $100 $200 $300 $400 $500 $100 $200 $300.

Fractions/Decimals/Percents By Me Date:. Look at this car.

Lesson 2.6: Perimeters and Areas of similar Figures Essential Question: How do changes in side length of similar figures affect the perimeters and areas.

Fractions, Decimals, and Percents

$100 $200 $300 $400 $100 $200 $300 $400 $300 $200 $100 Fraction with pictures Convert mixed to improper fractions Convert improper to mixed fractions.

(A) RdRP 5‘UTR3‘UTR CP MP SP6 (B) (C) 3 dpi 15 dpi (D) Supplementary Figure 1 Infectivity analysis of Nicotiana tabacum. Schematic illustration of the.

Hmmmmm..Pie!. WALT understand and interpret pie charts.

Fractional Parts of a Whole By:. What part of this object is colored red?

FRACTIONS & SHAPES BY:. How many of these are colored red? * out of *.

= 5 = 2 = 4 = 3 How could I make 13 from these shapes? How could I make 19 from these shapes? STARTER.

By Mdm Yvonne Ong. Jane has 30 fish. Amy has 24 fish. Express the number of fish Jane has as a fraction to the number of fish Amy has. J A = = 5.

Fractions and Sets 9-3 I can show and understand that fractions are equal parts of a whole. 3.NF.1.

An urn contains 1 green, 2 red, and 3 blue marbles. Draw two without replacement. 1/6 2/6 3/6 2/5 3/5 1/5 3/5 1/5 2/5 2/30 3/30 2/30 6/30 3/30 6/30.

Mathsercise-C Probability Trees Ready? Here we go!

Scientific Notation. = 5.4 =3.47 Write the following in standard form A 1.8 X 10⁴ B 3.47 X 10⁷ C 4.3 X 10⁰ D 5.4 X 10⁻⁴ E 5 X 10⁻⁶ F (6 X 10⁴) (7 X 10⁵)

Drought in the Western U.S.. Mean US Precipitation (in inches) Average Precipitation in 1 Year (in inches):

ПЕЧЕНЬ 9. Закладка печени в период эмбрионального развития.

Catch the Wave Wave Rate D = measured distance between sensors.

5-4 Your brother gave you two bags of pens. One bag contained 3 blue pens and 9 red pens. The other bag contained 6 red pens and 4 green pens. Which bag.

Lab# 5 Western Blot BCH 462[practical].

Type your name and send:

pH at which it changes colour

1A 1B 1D Supplementary figure 1. A DArT-based genetic map of wheat

RNA fraction WASH 3X 0.3M guanidine hydrochloride in 95% EtOH

Supplementary Figure 1.

Name: ______________________ Date: ________________ #: ____

Okadaic-Acid-Induced Inhibition of Protein Phosphatase 2A Produces Activation of Mitogen-Activated Protein Kinases ERK1/2, MEK1/2, and p70 S6, Similar.

Chemical Engineering Explained

Climate Graphs What do they tell us?.

Climate Graphs What do they tell us?.

Election #1 Popular Vote Electoral Vote State Red Yellow

Name: _______________________________

Supplementary Figure 2 Secondary transplanted brain tumors from PASC1 express human GH. Immuno-fluorescence staining of brain sections from mice implanted.

Fractional Parts of Objects

Fig. S2-B FigureS2. Trade-off between spatial and temporal information. Solid connectors represent spatially reduced versions, while dashed connectors.

Fractions 1/2 1/8 1/3 6/8 3/4.

A. C. B. D. Bifidobacterium mono-culture Bifidobacterium mono-culture

A B C D E CD20 CagA DAPI Merge Supplementary Figure 1.

What type of tissue is indicated by the blue arrow?

Surface Areas of Prisms and Cylinders

Can I color yellow?. Can I color yellow?

Here are four triangles. What do all of these triangles have in common

#. shop now P1080P · /' '

Plasticity of Adult Stem Cells

Supplemental Figure S4. Expression changes of phased and non-phased siRNAs among the three tissues examined The expression changes of phased and non-phased.

What Color is it?.

Lutz et al, Neuropsychopharmacology

a MELLFLGTGAGIPAKARNVTSVALKLLEERRSVWLFDCGEATQHQILHTT

Figure 4. Differentially expressed miRNAs and isomiRNAs between different pairs of tissues The differentially expressed miRNAs and their isomiRNAs are.

Ratio: Converting ratio to fractions

Figure 7. Expression changes of phased and non-phased siRNAs among the three tissues examined The expression changes of phased and non-phased siRNAs between.

A B Supplementary Figure S1 PC3 cells Vehicle 3β-Adiol

1. Identify the tissue.

Probability Word Problems

Lab# 5 Western Blot BCH 462[practical].

Tissue Formative Quiz.

Fraction Action With Mrs Ford.

The JNK phosphatase M3/6 is inhibited by protein-damaging stress

Headband In this figure, red and blue lines are closely correlated, means suspect has knowledge of crime. In this figure, red and blue lines.

Presentation transcript:

Tissue homogenate with precipitation Tissue homogenate without precipitation Cy5: PP2A 0.1 U Cy5: PP2A 1U Cy3: PP2A 0.1 U Cy3: PP2A 1U Cy5: PP2A 1U Supplementary Figure 2 pH 7pH 4

Cy5: PP1 1U Cy3: PP1 1UCy3: PP1 10U Cy5: PP1 10U Cy5: PP1 1U Cy3: PP1 1U Tissue homogenate with precipitation Tissue homogenate without precipitation Supplementary Figure 3 pH 7pH 4

Cy5: AP 1U Cy3: AP 1U Cy3: AP 10U Cy5: AP 10U Cy3: AP 10U Cy5: AP 10U Tissue homogenate with precipitation Tissue homogenate without precipitation Supplementary Figure 4 pH 7pH 4

Cy5: -PP 10U Cy3: -PP 10U Cy3: -PP 100U Cy5: -PP 100U Cy3: -PP 100U Tissue homogenate with precipitation Tissue homogenate without precipitation Supplementary Figure 5 pH 7pH 4

Cy5: AP 10U, pH 9 Cy3: AP 10U, pH 9 Cy5: AP 10U, pH 9 Tissue homogenate with precipitation Tissue homogenate without precipitation Supplementary Figure 6 pH 7pH 4

Mitochondrial-enriched fraction resuspended in SDS/HEPES buffer (H-buffer) Mitochondrial-enriched fraction resuspended in phosphatase buffer (P-buffer) Cy3: AP 10U Cy5: -PP 100U Cy5: AP 10U Cy3: -PP 100U Cy5: AP 10U Supplementary Figure 7 pH 7pH 4

0.5U AP:Cy3 (green) 0.5U PP1: Cy5 (red) 0.5U PP2A: Cy2 (blue) Supplementary Figure 8 pH 7pH 4