A B C D E F G H I J K FigS1. Supplemental Figure S1. Evolutionary relationships of Arabidopsis and tomato Aux/IAA proteins. The evolutionary history was.

Slides:

Advertisements

Similar presentations

Blast to Psi-Blast Blast makes use of Scoring Matrix derived from large number of proteins. What if you want to find homologs based upon a specific gene.

Advertisements

1 Orthologs: Two genes, each from a different species, that descended from a single common ancestral gene Paralogs: Two or more genes, often thought of.

Profiles for Sequences

Molecular Evolution Revised 29/12/06

HIDDEN MARKOV MODELS IN MULTIPLE ALIGNMENT. 2 HMM Architecture Markov Chains What is a Hidden Markov Model(HMM)? Components of HMM Problems of HMMs.

Multiple alignment June 29, 2007 Learning objectives- Review sequence alignment answer and answer questions you may have. Understand how the E value may.

TGCAAACTCAAACTCTTTTGTTGTTCTTACTGTATCATTGCCCAGAATAT TCTGCCTGTCTTTAGAGGCTAATACATTGATTAGTGAATTCCAATGGGCA GAATCGTGATGCATTAAAGAGATGCTAATATTTTCACTGCTCCTCAATTT.

Multiple Sequence Alignment May 12, 2009 Announcements Quiz #2 return (average 30) Hand in homework #7 Learning objectives-Understand ClustalW Homework#8-Due.

Pollen transcript unigene identifier log 2 -fold change Annotation (BLAST) Unigene L. longiflorum chloroplast, complete genome Unigene

Figure S1_Yao Qin et al. Figure S1 Occurrence and distribution of trihelix family in different plant species. Red branches in the cladogram indicate that.

Multiple Alignment and Phylogenetic Trees Csc 487/687 Computing for Bioinformatics.

Building phylogenetic trees. Contents Phylogeny Phylogenetic trees How to make a phylogenetic tree from pairwise distances  UPGMA method (+ an example)

Calculating branch lengths from distances. ABC A B C----- a b c.

PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1.

Multiple Alignment and Phylogenetic Trees Csc 487/687 Computing for Bioinformatics.

Figure S1 Evolutionary relationships of RBG subclasses in Arabidopsis (a) and B. rapa (b). Optimal neighbor-joining trees with sum of branch lengths =

Figure S1 Figure S1. Effect of SA on spore germination of M. oryae. The data presented were the means (± standard error) of spore germination from three.

F B Allele group II E G U S V W Rec OS1 Substitution Rec OS2 Rec OS3 A B C Rec OS1 Rec OS2 Rec OS3 (-530 ~ -86) (-86 ~ +49) Fig. S1 Intragenic recombination.

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

Figure 1 Myotubularin exhibits a tyrosine phosphatase activity

Supplemental Fig. S1 A B AtMYBS aa AtMYBS

Julián Mateus1 • Stef de Haan2 Carlos Chuquillanqui2

WRKY transcription factors in potato genome factors in potato genome

Julián Mateus1 • Stef de Haan2 Carlos Chuquillanqui2

Carlos Chuquillanqui1 • Ian Barker1

AtIAA18 AtIAA6 AtIAA19 VvIAA19 AtIAA10 AtIAA20 AtIAA7 AtIAA30 AtIAA11

Phylogenetic analysis of CADs and oxidoreductases involved in specialized metabolism (ORSMs). Phylogenetic analysis of CADs and oxidoreductases involved.

Carlos Chuquillanqui1 • Ian Barker1

Amino‐acid sequence of the heterogeneous nuclear RNP G protein family and RNA‐binding SELEX consensus sequence obtained for human RBMY. (A) Sequence alignment.

Sequence and comparison of the SDS protein.

Julián Mateus1 • Stef de Haan2 Carlos Chuquillanqui2

Julián Mateus1 • Stef de Haan2 Carlos Chuquillanqui2

WRKY transcription factors in potato genome factors in potato genome

Volume 9, Issue 3, Pages (March 2016)

Relationship between Genotype and Phenotype

Julián Mateus1 • Stef de Haan2 Carlos Chuquillanqui2

Evolutionary relationships of H-NS, StpA, and third H-NS paralogues in different members of Enterobacteriaceae. Evolutionary relationships of H-NS, StpA,

L. Dubourg Clinical Microbiology and Infection

Gene structures, positions of mutations, and protein domains of PRP18 paralogs in Arabidopsis. Gene structures, positions of mutations, and protein domains.

AtG3BP1 is a homolog of the human HsG3BP1.

Phylogenetic relationships within the family Astroviridae.

Volume 9, Issue 9, Pages (September 2016)

Ehrlichia canis phylogenetic analysis of the Borgo (Corsica) strain

Maximum-likelihood phylogenetic tree of norovirus genomes belonging to genogroup GI, with the norovirus GII reference genome as an outlier. Maximum-likelihood.

Genomes with Fe-S cluster assembly-related genes.

Volume 10, Issue 14, Pages R512-R513 (July 2000)

Maximum likelihood (ML) unrooted tree based on the full-length 16S rRNA genes (A) and 31 conserved single-copy genes (B) showing the phylogenetic position.

High-Throughput Identification and Quantification of Candida Species Using High Resolution Derivative Melt Analysis of Panfungal Amplicons Tasneem Mandviwala,

Julián Mateus1 • Stef de Haan2 Carlos Chuquillanqui2

(A) Tiled view of an ESOM map constructed using all 51 metagenome bins assembled from the samples collected in this study, with the white square encompassing.

Volume 8, Issue 7, Pages (July 2015)

Justin R. Bailey, Eleanor Barnes, Andrea L. Cox Gastroenterology

EPS15 and EPS15L1 are expressed during erythropoiesis and they are absent in Tie2+ cells from cDKO mice. EPS15 and EPS15L1 are expressed during erythropoiesis.

Julián Mateus1 • Stef de Haan2 Carlos Chuquillanqui2

Prevalence of CXCR4-tropic viruses in clustered transmission chains at the time of primary HIV-1 infection P. Frange, L. Meyer, J. Ghosn, C. Deveau,

Schematic drawing of alternatively-spliced GFP reporter gene.

* * * * * * * Supplemental Figure 3. GO Cellular Component Annotation Analysis of SA-Regulated Gene-Networks. We analyzed the genes in the gene-networks.

Simon Laurin-Lemay, Henner Brinkmann, Hervé Philippe Current Biology

Correction of Gene Annotation and Other Sequence Analysis of Arabidopsis Proteins Identified on the 2-D Gels in Figure 1.(A) Spot 71, identified as a 17.2-kD.

Phylogenetic analysis and amino acid sequences comparison of HO endonucleases. Phylogenetic analysis and amino acid sequences comparison of HO endonucleases.

Shifty Ciliates Lawrence A. Klobutcher, Philip J. Farabaugh Cell

Two cycad AOX genes, CrAOX1 and CrAOX2, showing different expression patterns in thermogenic male cones. Two cycad AOX genes, CrAOX1 and CrAOX2, showing.

Core genome phylogeny of V. anguillarum strains.

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

Jean-Louis Boulay, John J. O'Shea, William E. Paul Immunity

Novel West Nile virus lineage 1a full genome sequences from human cases of infection in north-eastern Italy, 2011 L. Barzon Clinical Microbiology and.

Phylogenetic analysis of AquK2P.

Phylogenetic tree based on predominant 16S rRNA gene sequences obtained by C4–V8 Sutterella PCR from AUT-GI patients, Sutterella species isolates, and.

Molecular phylogenetic analysis of RNA polymerase II largest-subunit protein sequences from various trichomonads, including D. fragilis. Molecular phylogenetic.

Functional Insights of Plant GSK3-like Kinases: Multi-Taskers in Diverse Cellular Signal Transduction Pathways Ji-Hyun Youn, Tae-Wuk Kim Molecular Plant

Presentation transcript:

A B C D E F G H I J K FigS1

Supplemental Figure S1. Evolutionary relationships of Arabidopsis and tomato Aux/IAA proteins. The evolutionary history was inferred using the Neighbor-Joining method (Saitou and Nei, 1987). The optimal tree with the sum of branch length = is shown. The evolutionary distances were computed using the Poisson correction method (Zuckerkandl and Pauling, 1965) and are in the units of the number of amino acid substitutions per site. The analysis involved 54 amino acid sequences. All positions containing gaps and missing data were eliminated. There were a total of 68 positions in the final dataset. Evolutionary analyses were conducted in MEGA5 (Tamura et al., 2011).

FigS2 Supplemental Figure S2. Genomic distribution of Aux/IAA genes on tomato chromosomes. The arrows next to gene names show the direction of transcription. The number in parentheses designates the position of the ATG of each Aux/IAA gene in megabases (Mb) on tomato chromosome pseudomolecules (Tomato Whole Genome Scaffolds data V2.4). The chromosome numbers are indicated at the top of each bar.

FigS3 B LxLxLx motifDLxLxLx motif A LxLxLxLxL motif

Supplemental Figure S3. Amino acid sequences for IAA proteins that contain an atypical domain I (A) Amino acid sequences for IAA proteins that contain an expanded repression domain I. Amino acid sequence comparison of tomato Sl-IAA11, Sl-IAA12 and Sl-IAA13 with those from Arabidopsis AtIAA10 (AT1G04100), AtIAA11 (AT4G28640), AtIAA12 (AT1G04550) and AtIAA13 (AT1G04550). The conserved LxLxLxLxLx motif is underlined. The sequences were aligned with Clustal X method and adjusted manually. (B) Amino acid sequences between conserved domains I and II for IAA proteins that contain a second LxLxL motif. Amino acid sequence comparison of tomato Sl-IAA7, Sl-IAA14, Sl-IAA16 and Sl-IAA17 with those from Arabidopsis AtIAA7 (AT3G23050), AtIAA14 (AT4G14550), AtIAA16 (AT3G04730) and AtIAA17 (AT1G04250). The conserved LxLxLx motif (Domain I) and the DLxLxL motif are underlined. The sequences were aligned with Clustal X method and adjusted manually.