Changes In Protein Sequences Of the HIV-1 gp120 V3 Region In Non-Progressor Types Nicki S.Harmon Samantha M. Hurndon LMU Department of Biology BIOL 368.

Slides:

Advertisements

Similar presentations

Changes In Protein Sequences Of the HIV-1 gp120 V3 Region In Non-Progressor Types Nicki S.Harmon Samantha M. Hurndon.

Advertisements

Genetic Similarities Between HIV-1 Viruses in the Onset of AIDS Isabel Gonzaga BIOL : Bioinformatics Laboratory Loyola Marymount University October.

Dual conformations for the HIV-1 gp120 V3 loop in complexes with different neutralizing Fabs RL Stanfield, E Cabezas, AC Satterthwait, EA Stura, AT Profy,

Measuring the degree of similarity: PAM and blosum Matrix

Profile-profile alignment using hidden Markov models Wing Wong.

Sequence similarity.

HIV GP120 Envelope Protein

An Introduction to the HIV Problem Space Oakwood University: Faculty Quantitative Institute Aug. 10–12, 2009.

Examination of Amino Acid Differences as a Means of Determining Functional Changes in HIV-1 Protein Sequences Chris Rhodes and Isaiah Castaneda Loyola.

Lecture 2 Antigens, Receptors and Immunoglobulins.

Analysis of HIV Evolution Bobak Seddighzadeh and Kristoffer Chin Department of Biology Loyola Marymount University Bio February 23, 2010.

Examining Subjects of HIV-1 With Possible Predominant Viral Strains Samantha Hurndon Isaiah Castaneda.

Multiple Alignment and Phylogenetic Trees Csc 487/687 Computing for Bioinformatics.

Unconserved Amino Acid Sequences in V3 Domain of gp120 Show No Significant Correlation to Altered Folding and Function Bobak Seddighzadeh Alex George.

STEPHANIE HINTZEN BIOL 471 SIV and HIV: Differences in Diversity and Divergence.

Re evaluating the Categorization of HIV Progression in Subjects Based on CD4 T cell Decline Rates Angela Garibaldi & Ryan Willhite Loyola Marymount University.

Construction of Substitution Matrices

A Mutational Investigation of an HIV Patient’s GP120 Glycoprotein and it’s Implications on CD4 Binding Salita Kaistha Usrinus College, Collegeville PA.

Proteins Chapter 5 Big Idea #2: Structure Meets Function.

Predicting the Onset of AIDS Robert Arnold, Alex Cardenas, Zeb Russo LMU Biology Department 10/5/2011.

Supporting Scientific Collaboration Online SCOPE Workshop at San Diego Supercomputer Center March 19-22, 2008.

Patterns of selection for or against amino acid change among different CD4 T-cell count progressor groups Michael Pina, Salomon Garcia Journal Club Presentation.

Diversity and Divergence in HIV-1 Viral Variants between patients with high CD4+ T Cell Variability and Patients with Rapid CD4+ T Cell Decline Kevin Paiz-Ramirez.

Mutations on the V3 loop of gp120 may predict progression to AIDS Derese Getnet, Dr. Rebecca Roberts, Structural Biology, Ursinus College, Collegeville.

Amino Acid Sequences in V3 Loop Conformation Alex Cardenas, Bobby Arnold and Zeb Russo Loyola Marymount University Department of Biology BIO /02/11.

Project in BioInformatics Variability of Membrane proteins of different HIV strains By Emad Nimer Wisam Kadry.

Predicting the Onset of AIDS Robert Arnold, Alex Cardenas, Zeb Russo LMU Biology Department 10/5/2011.

Residue Sequence and Structure in the Re evaluation the Categorization of HIV Progression in Subjects Based on CD4 T cell Decline Rates Angela Garibaldi.

Examining Subjects of HIV-1 With Possible Predominant Viral Strains Samantha Hurndon Isaiah Castaneda.

Role of V3 in HIV Entry and Neutralization Chloe Jones, Isabel Gonzaga, and Nicole Anguiano BIOL398: Bioinformatics Laboratory Loyola Marymount University.

Analyzing Differences in Protein Sequences Between Subjects with Varying T Cell Counts J’aime Moehlman Amanda Wavrin Loyola Marymount University March.

Construction of Substitution matrices

Examining the Genetic Similarity and Difference of the Three Progressor Groups at the First and Middle Visits Nicole Anguiano BIOL398: Bioinformatics Laboratory.

Examining Genetic Similarity and Difference of the Three Progressor Groups at the First and Middle Visits Nicole Anguiano Bioinformatics Laboratory Loyola.

V3 Loop Binding to CCR5 and CXCR4 of Rapid and Non Progressor HIV Patients in Baltimore MD BackgroundCCR5 and CXCR4 Receptor Rapid-progressor Patient 10.

Structure of V3-containing HIV-1 gp120 core Huang, C. C., Tang, M., Zhang, M. Y., Majeed, S., Montabana, E., Stanfield, R. L., Dimitrov, D. S., Korber,

Residue Sequence and Structure in the Re evaluation the Categorization of HIV Progression in Subjects Based on CD4 T cell Decline Rates Angela Garibaldi.

Examining Genetic Similarity and Difference of the Three Progressor Groups at the First and Middle Visits Nicole Anguiano BIOL398: Bioinformatics Laboratory.

Investigations of HIV-1 Env Evolution Evolutionary Bioinformatics Education: A BioQUEST Curriculum Consortium Approach Grand Valley State University August.

Patterns of HIV-1 evolution in individuals with differing rates of CD4 T cell decline Markham RB, Wang WC, Weisstein AE, Wang Z, Munoz A, Templeton A,

HIV ‐ 1 replication activates CD4 + T cells with specificities for persistent herpes viruses by Anna Haas, Manuela Rehr, Frederik Graw, Peter Rusert, Walter.

Substitution Matrices and Alignment Statistics BMI/CS 776 Mark Craven February 2002.

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

Journal Club Presentation BIOL368/F16: Bioinformatics Laboratory

Colin Wikholm William Fuchs

Amino Acid Sequences in V3 Loop Conformation

The V3 Region Expresses More Diversity in Amino Acid Sequence in AIDS Diagnosed Patients than in Non-Trending and AIDS Progressing Patients HIV Structure.

Do HIV+ Rapid Progressors Show More Divergence than Non-Progressors?

Amino Acid Sequences in V3 Loop Conformation

There are four levels of structure in proteins

Predicting the Onset of AIDS

Volume 9, Issue 2, Pages (February 2002)

Patterns of HIV-1 evolution in individuals with differing rates of CD4 T cell decline Markham RB, Wang WC, Weisstein AE, Wang Z, Munoz A, Templeton A,

Investigations of HIV-1 Env Evolution

Loyola Marymount University

LMU Department of Biology

Dual conformations for the HIV-1 gp120 V3 loop in complexes with different neutralizing Fabs RL Stanfield, E Cabezas, AC Satterthwait, EA Stura, AT Profy,

Predicting the Onset of AIDS

Loyola Marymount University

Loyola Marymount University

Nicki Harmon, Samantha Hurndon, & Zeb Russo

Amino Acid Sequences in V3 Loop Conformation

Patterns of HIV-1 evolution in individuals with differing rates of CD4 T cell decline Markham RB, Wang WC, Weisstein AE, Wang Z, Munoz A, Templeton A,

Predicting the Onset of AIDS

Residue Sequence and Structure in the Re evaluation the Categorization of HIV Progression in Subjects Based on CD4 T cell Decline Rates Angela Garibaldi.

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

Chloe Jones, Isabel Gonzaga, and Nicole Anguiano

Loyola Marymount University

Selectivity-determining regions

Presentation transcript:

Changes In Protein Sequences Of the HIV-1 gp120 V3 Region In Non-Progressor Types Nicki S.Harmon Samantha M. Hurndon LMU Department of Biology BIOL /2/11

Outline The V3 region and non-progressor types as defined by Markham. Changes in Amino Acid Sequence between various subjects in the moderate progressor and non-progressor categories. Sequence Alignment tools and Secondary Structure tools were used to identify changes between the subjects. What the data reveals about the relation between sequence and secondary structure in the V3 region of HIV-1.

The Amino Acid Sequence of the V3 Region Plays A Significant Role in CD4 Binding. The V3 region of the gp 120 env protein is a variable loop with a high mutation rate. V3 is what binds to the CD4 receptor sites on cell. The amino acid sequence determines how the V3 region will function. – And therefore, how the CD4 will interact

HIV-1 Progresses at Different Rate Markham observed 3 types of progressors – Non-progressors Maintained CD4 T cell levels above 650 throughout the Observation period. – Moderate CD4 T cell levels declined to during the observation period – Rapid Having attained a level of fewer than 200 CD4 T cells

Outline The V3 region and non-progressor types as defined by Markham. Changes in Amino Acid Sequence between various subjects in the moderate progressor and non-progressor categories. Sequence Alignment tools and Secondary Structure tools were used to identify changes between the subjects. What the data reveals about the relation between sequence and secondary structure in the V3 region of HIV-1.

The Non-Progressor Types Should Have Amino Acid Sequences that are Closely Related Since the CD4 T cell are being maintained in the non- progressor types, there should not be a lot of divergence between these sequences. We expect in changes in sequence between the non- progressors to not be significant. There should be points of divergence between a moderate progressor and the non-progressors.

Methods were Based off Markham’s Findings The subjects that we selected for our study were subjects 2, 12, 13 and 8. Subject 2, 12 and 13 are non progressor types Subject 8 is a moderate progressor that will be used as a comparison to our non progressor subjects

Outline The V3 region and non-progressor types as defined by Markham. Changes in Amino Acid Sequence between various subjects in the moderate progressor and non-progressor categories. Sequence Alignment tools and Secondary Structure tools were used to identify changes between the subjects. What the data reveals about the relation between sequence and secondary structure in the V3 region of HIV-1.

Determination of Sequence were Randomly Selected Due to the nature of the non-progressor type, sequence selection can be random. Subject 8 showed a change over the course of the study. Due to this change sequences from the first and last visits were chosen.

Amino Acid Sequences were Retrieved For Our Subjects The program Bedrock was use to access our sequences.

Analysis of Multiple Sequences Alignment Shows Conservation of Residues

Secondary Structure Is Maintained Throughout The Subjects

Outline The V3 region and non-progressor types as defined by Markham. Changes in Amino Acid Sequence between various subjects in the moderate progressor and non-progressor categories. Sequence Alignment tools and Secondary Structure tools were used to identify changes between the subjects. What the data reveals about the relation between sequence and secondary structure in the V3 region of HIV-1.

Conclusions We Can Make Based Off Sequences From Subjects 2, 12, 13 & 8 The Non-Progressor types had similar amino acid sequences. There were changes between the non-progressors and subject 8 that could account for subject 8 being a moderate progressor. Secondary structure was not affected by these changes in sequence.

References Positive In Vivo Selection of the HIV-1 Envelope Protein gp120 Occurs at Surface-Exposed Regions Beda Joos1, Beda Joos1 Marek Fischer1, Marek Fischer1 Andreas Schweizer1, Andreas Schweizer1 Herbert Kuster1, Herbert Kuster1 Jürg Böni2, Jürg Böni2 Joseph K. Wong3, Joseph K. Wong3 Rainer Weber1, Rainer Weber1 Alexandra Trkola1 and Alexandra Trkola1 Huldrych F. Günthard1 Huldrych F. Günthard1