Construction of Substitution matrices

Slides:

Advertisements

Similar presentations

Fa07CSE 182 CSE182-L4: Database filtering. Fa07CSE 182 Summary (through lecture 3) A2 is online We considered the basics of sequence alignment –Opt score.

Advertisements

Blast outputoutput. How to measure the similarity between two sequences Q: which one is a better match to the query ? Query: M A T W L Seq_A: M A T P.

1 Introduction to Sequence Analysis Utah State University – Spring 2012 STAT 5570: Statistical Bioinformatics Notes 6.1.

Sources Page & Holmes Vladimir Likic presentation: 20show.pdf

Gapped Blast and PSI BLAST Basic Local Alignment Search Tool ~Sean Boyle Basic Local Alignment Search Tool ~Sean Boyle.

Measuring the degree of similarity: PAM and blosum Matrix

DNA sequences alignment measurement

Lecture 8 Alignment of pairs of sequence Local and global alignment

Local alignments Seq X: Seq Y:. Local alignment  What’s local? –Allow only parts of the sequence to match –Results in High Scoring Segments –Locally.

Sequence Similarity Searching Class 4 March 2010.

Optimatization of a New Score Function for the Detection of Remote Homologs Kann et al.

Heuristic alignment algorithms and cost matrices

Sequence similarity (II). Schedule Mar 23midterm assignedalignment Mar 30midterm dueprot struct/drugs April 6teams assignedprot struct/drugs April 13RNA.

Introduction to Bioinformatics Algorithms Sequence Alignment.

Alignment methods and database searching April 14, 2005 Quiz#1 today Learning objectives- Finish Dotter Program analysis. Understand how to use the program.

BNFO 240 Usman Roshan. Last time Traceback for alignment How to select the gap penalties? Benchmark alignments –Structural superimposition –BAliBASE.

Introduction to bioinformatics

Sequence similarity.

Alignment methods June 26, 2007 Learning objectives- Understand how Global alignment program works. Understand how Local alignment program works.

Similar Sequence Similar Function Charles Yan Spring 2006.

Sequence Alignment III CIS 667 February 10, 2004.

Heuristic Approaches for Sequence Alignments

BLOSUM Information Resources Algorithms in Computational Biology Spring 2006 Created by Itai Sharon.

Bioinformatics Unit 1: Data Bases and Alignments Lecture 3: “Homology” Searches and Sequence Alignments (cont.) The Mechanics of Alignments.

Sequence Alignments Revisited

Alignment IV BLOSUM Matrices. 2 BLOSUM matrices Blocks Substitution Matrix. Scores for each position are obtained frequencies of substitutions in blocks.

Alignment III PAM Matrices. 2 PAM250 scoring matrix.

Sequence similarity. Motivation Same gene, or similar gene Suffix of A similar to prefix of B? Suffix of A similar to prefix of B..Z? Longest similar.

Blast heuristics Morten Nielsen Department of Systems Biology, DTU.

Introduction to Bioinformatics From Pairwise to Multiple Alignment.

Alignment methods II April 24, 2007 Learning objectives- 1) Understand how Global alignment program works using the longest common subsequence method.

Alignment Statistics and Substitution Matrices BMI/CS 576 Colin Dewey Fall 2010.

An Introduction to Bioinformatics

Chapter 11 Assessing Pairwise Sequence Similarity: BLAST and FASTA (Lecture follows chapter pretty closely) This lecture is designed to introduce you to.

Evolution and Scoring Rules Example Score = 5 x (# matches) + (-4) x (# mismatches) + + (-7) x (total length of all gaps) Example Score = 5 x (# matches)

Sequence Alignment Goal: line up two or more sequences An alignment of two amino acid sequences: …. Seq1: HKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITN-EYMKEDFLIKIETWHKP.

Amino Acid Scoring Matrices Jason Davis. Overview Protein synthesis/evolution Protein synthesis/evolution Computational sequence alignment Computational.

Pairwise Sequence Alignment. The most important class of bioinformatics tools – pairwise alignment of DNA and protein seqs. alignment 1alignment 2 Seq.

Eric C. Rouchka, University of Louisville Sequence Database Searching Eric Rouchka, D.Sc. Bioinformatics Journal Club October.

Pairwise alignment of DNA/protein sequences I519 Introduction to Bioinformatics, Fall 2012.

Scoring Matrices April 23, 2009 Learning objectives- 1) Last word on Global Alignment 2) Understand how the Smith-Waterman algorithm can be applied to.

Bacterial Genetics - Assignment and Genomics Exercise: Aims –To provide an overview of the development and.

Comp. Genomics Recitation 3 The statistics of database searching.

Construction of Substitution Matrices

Calculating branch lengths from distances. ABC A B C----- a b c.

Sequence Alignment Csc 487/687 Computing for bioinformatics.

Function preserves sequences Christophe Roos - MediCel ltd Similarity is a tool in understanding the information in a sequence.

Tutorial 4 Substitution matrices and PSI-BLAST 1.

BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio CS 466 Saurabh Sinha.

Biocomputation: Comparative Genomics Tanya Talkar Lolly Kruse Colleen O’Rourke.

©CMBI 2005 Database Searching BLAST Database Searching Sequence Alignment Scoring Matrices Significance of an alignment BLAST, algorithm BLAST, parameters.

Doug Raiford Lesson 5.  Dynamic programming methods  Needleman-Wunsch (global alignment)  Smith-Waterman (local alignment)  BLAST Fixed: best Linear:

Sequence Alignment.

Bioinformatics Computing 1 CMP 807 – Day 2 Kevin Galens.

Step 3: Tools Database Searching

The statistics of pairwise alignment BMI/CS 576 Colin Dewey Fall 2015.

©CMBI 2005 Database Searching BLAST Database Searching Sequence Alignment Scoring Matrices Significance of an alignment BLAST, algorithm BLAST, parameters.

BLAST: Database Search Heuristic Algorithm Some slides courtesy of Dr. Pevsner and Dr. Dirk Husmeier.

Techniques for Protein Sequence Alignment and Database Searching G P S Raghava Scientist & Head Bioinformatics Centre, Institute of Microbial Technology,

Tutorial 4 Comparing Protein Sequences Intro to Bioinformatics 1.

Substitution Matrices and Alignment Statistics BMI/CS 776 Mark Craven February 2002.

9/6/07BCB 444/544 F07 ISU Dobbs - Lab 3 - BLAST1 BCB 444/544 Lab 3 BLAST Scoring Matrices & Alignment Statistics Sept6.

Pairwise Sequence Alignment and Database Searching

Computer Applications and Bioinformatics

Sequence similarity, BLAST alignments & multiple sequence alignments

Basics of BLAST Basic BLAST Search - What is BLAST?

Alignment IV BLOSUM Matrices

Basic Local Alignment Search Tool

Presentation transcript:

Construction of Substitution matrices BLOSUM BLOCKS SUBSTITUTION MATRIX PAM POINT ACCEPTED MUTATIONS

Substitution matrices Substitution matrix contains values proportional to the probability that amino acid A mutates into amino acid B for all pairs of amino acids through a period of evolution Substitution matrices are constructed from a large and diverse sample of sequence alignments

How to construct substitution matrices Multiple alignment of well studies gene sequences from different species use orthologs: functionally similar observed substitutions tend to preserve functions minimal gaps

How to construct substitution matrices ? Tabulate substitutions A to A: 9867 times A to R: 2 times A to N: 9 times etc….

How to construct substitution matrices ?

Construction of Substitution matrices BLOSUM

Construction of Substitution matrices BLOSUM

How to construct substitution matrices ? Substitution matrix score = Log Observed mutation rate in alignment Expected random mutation rate

How do we find the random mutation rate?

The random mutation rate compute the overall occurrence of an amino acid in a protein database

The random mutation rate compute the overall occurrence of an amino acid in a protein database http://www.ebi.ac.uk/swissprot/sptr_stats/index.html

The random mutation rate Example: Expected random mutation rate is 1 in 10000 and observed mutation rate of W to R is 1 in 10 Score = log (0.1/0.0001) = log (1000) = +3

Calculating BLOSUM62 scores

Calculating BLOSUM62 scores

Calculating BLOSUM62 scores

Calculating BLOSUM62 scores

Calculating BLOSUM62 scores

Calculating BLOSUM62 scores

Calculating BLOSUM62 scores

Calculating BLOSUM62 scores

Calculating BLOSUM62 scores

Calculating BLOSUM62 scores

PAM matrices [1 point mutation per 100 amino acids] Point Accepted Mutations [1 point mutation per 100 amino acids] does not take into account different evolutionary rates between conserved and non-conserved regions

PAM1 is 1% average change in amino acids

Why use substitution matrices?????

Why use substitution matrices? Database searches

Database searching

Database searching

Database searching Query Sequence; Database sequences

Database searching: Filtering Dynamic programming is computationally expensive Apply DP to sequence pairs that are likely to be similar find short words: query-database DNA 7-28bases (BLAST?) PROTEIN 3 amino acids (BLAST?)

BLAST Basic Local Alignment Search Tool Heuristic method?

Blast output parameter E value

E value number of alignments one can expect see by chance. Number of alignments having the same or greater score. Dependent on size of database and length of query seq.