Supplemental Figure 1 GhCWIN1 (1) Atßfruct2 (1) Lin6 (1) NtCWIN1 (1) OsCWIN1 (1) ZmCWIN1 (1) Atßfruct4 (1) GhVIN1 (1) GhCWIN1 (45) Atßfruct2 (45) Lin6.

Slides:

Advertisements

Similar presentations

Figure S1. Quantification of stem diameter and stipule diameter of intact plants and plants with buds removed A.The stem diameter (arrow) at the base of.

Advertisements

The construction of cells DNA or RNA Protein Carbohydrates Lipid etc.

The construction of cells DNA or RNA Protein Carbohydrates Lipid etc. 04.

The construction of cells DNA or RNA Protein Carbohydrates Lipid etc

The construction of cells DNA or RNA Protein Carbohydrates Lipid etc

The construction of cells DNA or RNA Protein Carbohydrates Lipid etc.

Carbohydrates Definition : are macromolecules, consists of Carbon, Hydrogen and Oxygen. H and O are found in same proportion as in water (H2O). Biological.

Figure S1_Yao Qin et al. Figure S1 Occurrence and distribution of trihelix family in different plant species. Red branches in the cladogram indicate that.

Enzyme activity (μmol mg protein-1 min -1 ) DAA Xu-142 Xu-142 fl mutant CIN VIN CWIN (C) Supplemental Figure 1 Control.

MVKFLFSVIILFFLLSAVGSSARNIEEDGVIRLPSEVKDFINGKNIDDDSVGGTRWAVLI 60 AGSSGYWNYRHQADVCHAYQVLKRGGVKDENIVVFMYDDIALNEENPRPGVIINHPKGED 120 VYAGVPKDYTGRDVTAHNFYSVLLGNKTAVKGGSGKVIDSGPNDHIFIYYSDHGGPGVLG.

Etheridge_Fig. S1 NTD * * (368) (154) (296) (131) (146) (477) (271) (391) (141) (248) CTDCTD (570) (363) (483) (232) (340) (675) (446) (588) (318) (422)

Figure S1. Fiber and seed weight of T3 mature seeds on T2 individuals. GhVIN1-RNAi cotton exhibited reduced fiber yield per seed (a), but increased seed.

I Ia II Ib I IaIb IIIII IV V VI Figure S1. Comparison of amino acid sequence of O. sativa (Os) SUV3 (1-579) with SUV3 from A. thaliana (At) (1-571), H.

A B C D E F G H I J K FigS1. Supplemental Figure S1. Evolutionary relationships of Arabidopsis and tomato Aux/IAA proteins. The evolutionary history was.

Enzymes. Amino Acid Basic Structure Primary Structure.

Figure S1 Figure S1. European corn borer (ECB) oral secretions (OS) did not induce the expression of proteinase inhibitors in tomato and maize. (a) Relative.

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

HKT1 form Arabidopsis relative extremophile Thellungiella work as Na/K co-transporter.

Volume 5, Issue 2, Pages (March 2012)

Lab 2 Carbohydrates.

Figure 1 Myotubularin exhibits a tyrosine phosphatase activity

Supplemental Fig. S1 A B AtMYBS aa AtMYBS

Chapter 3 Molecules of Life (Sections )

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

Figure 1. Structure of the fly LGR2 gene and the corresponding cDNA sequence. A, Derivation of the fly LGR2 full-length cDNA from the genomic sequence.

Fig. 2 Expression and subcellular localization of MSL8–GFP expressed from endogenous sequences. (A) Quantitative RT–PCR amplification of MSL8 transcripts.

Fig. 1. (A) The nucleotide and deduced amino acid sequences of the vacuolar serine protease protein of F. proliferatum (Fus p , GenBank accession.

* * * Fig. S1 XB21-Os12g36180 Os11g43950 At4g12770 At4g

There are four levels of structure in proteins

Tomato Ovary-to-Fruit Transition is Characterized by a Spatial Shift of mRNAs for Cell Wall Invertase and its Inhibitor with the Encoded Proteins Localized.

Supplemental Figure S1. Alignment of drimenol synthase amino acid sequences from P. hydropiper and V. officinalis. Amino acid sequences were aligned with.

Multiple sequence alignment and analysis of SOFL proteins.

Volume 5, Issue 2, Pages (March 2012)

Volume 4, Issue 1, Pages (January 2011)

Engineering a Protein Scaffold from a PHD Finger

GLUTAMINASE - Phylogenetic tree construction

The CLAVATA1Gene Encodes a Putative Receptor Kinase That Controls Shoot and Floral Meristem Size in Arabidopsis Steven E Clark, Robert W Williams, Elliot.

Figure 1: The full-length cDNA and deduced amino acid sequences of Lysozyme C and amino acid sequences from rock bream, Oplegnathus fasciatus. The primers.

Volume 5, Issue 3, Pages (May 2012)

Andrew D Basehoar, Sara J Zanton, B.Franklin Pugh Cell

Where would you draw the polyA tail in the gene above?______________

Drosophila sickle Is a Novel grim-reaper Cell Death Activator

Luis Sanchez-Pulido, John F.X. Diffley, Chris P. Ponting

Volume 90, Issue 4, Pages (August 1997)

Edith Schlagenhauf, Robert Etges, Peter Metcalf Structure

Sugar Input, Metabolism, and Signaling Mediated by Invertase: Roles in Development, Yield Potential, and Response to Drought and Heat Ruan Yong-Ling.

Volume 8, Issue 7, Pages (July 2015)

CARPEL FACTORY, a Dicer Homolog, and HEN1, a Novel Protein, Act in microRNA Metabolism in Arabidopsis thaliana Wonkeun Park, Junjie Li, Rentao Song,

Cell Signalling: Receptor orphans find a family

Alex Bateman, Cyrus Chothia Current Biology

Volume 7, Issue 6, Pages (December 1997)

Characterization and Mutation Analysis of Human LEFTY A and LEFTY B, Homologues of Murine Genes Implicated in Left-Right Axis Development K. Kosaki,

Identification of the GCS1 ortholog in Gonium pectorale.

Correction of Gene Annotation and Other Sequence Analysis of Arabidopsis Proteins Identified on the 2-D Gels in Figure 1.(A) Spot 71, identified as a 17.2-kD.

Transcriptional Control of SLC26A4 Is Involved in Pendred Syndrome and Nonsyndromic Enlargement of Vestibular Aqueduct (DFNB4) Tao Yang, Hilmar Vidarsson,

Two cycad AOX genes, CrAOX1 and CrAOX2, showing different expression patterns in thermogenic male cones. Two cycad AOX genes, CrAOX1 and CrAOX2, showing.

Guilty as charged Cancer Cell

Comparison of the predicted amino acid sequences of murine Rin (GenBank accession number U71202), human Rin (U71204), murine Rit (U71205), human Rit (U71203),

Selectivity-determining regions

New microsome-associated HT-family proteins from Nicotiana respond to pollination and define an HT/NOD-24 protein family Kondo Katsuhiko , McClure Bruce.

Adam T. McGeoch, Stephen D. Bell Cell

The NB-ARC domain: a novel signalling motif shared by plant resistance gene products and regulators of cell death in animals Erik A. van der Biezen,

Xiaowu Gai, Daniel F. Voytas Molecular Cell

Volume 7, Issue 6, Pages (June 2001)

Volume 8, Issue 2, Pages (February 2015)

CCA1 Binds the Promoter of GI in Vitro and in Vivo.

Volume 97, Issue 6, Pages (June 1999)

Volume 7, Issue 12, Pages (December 2014)

Volume 1, Issue 3, Pages (May 2008)

Alignment of the Amino Acid Sequences of NCS and Other PR10/Bet v1 Proteins from Various Plant Species.Deduced amino acid sequences were aligned using.

Presentation transcript:

Supplemental Figure 1 GhCWIN1 (1) Atßfruct2 (1) Lin6 (1) NtCWIN1 (1) OsCWIN1 (1) ZmCWIN1 (1) Atßfruct4 (1) GhVIN1 (1) GhCWIN1 (45) Atßfruct2 (45) Lin6 (50) NtCWIN1 (49) OsCWIN1 (47) ZmCWIN1 (52) Atßfruct4 (98) GhVIN1 (96) GhCWIN1 (130) Atßfruct2 (129) Lin6 (133) NtCWIN1 (132) OsCWIN1 (130) ZmCWIN1 (135) Atßfruct1 (198) GhVIN1 (190) GhCWIN1 (224) Atßfruct2 (224) Lin6 (229) NtCWIN1 (227) OsCWIN1 (226) ZmCWIN1 (232) Atßfruct1 (292) GhVIN1 (285) GhCWIN1 (317) Atßfruct2 (320) Lin6 (324) NtCWIN1 (322) OsCWIN1 (318) ZmCWIN1 (326) Atßfruct1 (389) GhVIN1 (380) GhCWIN1 (414) Atßfruct2 (417) Lin6 (421) NtCWIN1 (419) OsCWIN1 (415) ZmCWIN1 (426) Atßfruct1 (487) GhVIN1 (479) GhCWIN1 (499) Atßfruct2 (513) Lin6 (510) NtCWIN1 (508) OsCWIN1 (503) ZmCWIN1 (515) Atßfruct1 (575) GhVIN1 (558)

Supplemental Figure 1. Alignment of GhCWIN1 sequence with five plant CWINs (Atβfruct2, Lin6, NtCWIN1, OsCWIN1 and ZmCWIN1) and two VINs (Atβfruct4 and GhVIN1). Thirteen boxed sequences indicate the conserved regions of plant invertases. The β-fructosidase motif (NDPD/NG) and cysteine catalytic domain (WECP/VD) were underlined. Arrowsheads denote five consistently different amino acids between VINs and CWINs. Arrow show GhCWIN1 signal sequence cleavage site between residue 19 and residue 20.

Plant CWIN Plant VIN Bacterial invertase Yeast invertase Plant CIN 0.1 Supplemental Figure 2 Supplemental Figure 2. Phylogenetic analysis classifies GhCWIN1 as a plant CWIN. Genbank accession number for each invetrase listed and the corresponding species were listed in Supplemental Table 1.

GhCWIN1 GhINH1 GhMST1 GhSUT1 Gh18srRNA Seed Filial tissue DAA Supplemental Figure 3. Transcript level of cotton cell wall invertase GhCWIN1, invertase inhibitor GhINH1, monosaccharide tranporter GhMST1, sucrose transporter GhSUT1 in cotton seed and filial tissue at different development stages. Gh18srRNA was used as an internal control. Supplemental Figure 3

a b b c a b b c Seed Seed coat Glucose content (mg g -1 FW) Glucose content (mg g -1 FW) Seed Filial tissue A a ab b b a b bc c Fructose content (mg g -1 FW) B Seed Seed coat Seed Filial tissue Fructose content (mg g -1 FW) a bc ab c Seed Filial tissue Sucrose content (mg g -1 FW) Sucrose content (mg g -1 FW) C Seed Seed coat Supplemental Figure 4 Supplemental Figure 4. Glucose (A), fructose (B) and sucrose (C) level in cotton seed, seed coat and filial tissue during development. Each value is the mean ± SE of at least three biological replicates. Different letters indicate significant differences at P ≤.05 according to randomization one-way ANOVA test.