Strategies of NK cell recognition NO ACTIVATION PROTECTION SELF TOLERANCE Normal cell MHC class I Inhibitory KIR/Ly49 Activating receptors + - Activating.

Slides:

Advertisements

Similar presentations

Fc Receptors Oct. 28, 2009 Extra reading on web Daniel Conrad 423 MSB, I. CD23.

Advertisements

Cell-Mediated Effector Responses Chapter 14

v SCF Ras GDP Inactive nucleus SCF Ras GDP Inactive nucleus.

1. General themes of transmembrane signaling - clustering and phosphorylation -  receptor protein tyrosine kinases  and  receptor-assoicated protein.

Reviews: update Hamerman, J. A., Ogasawara, K., Lanier, L. L. (2005). NK cells in innate immunity. Curr Opin Immunol 17, W.M. Yokoyama and S. Kim.

Natural Killer Cell Receptors

Reminders Midterm test on Tuesday Review session Saturday 4-6 PM, here. Reading: Chapters 3, 5, 6,

Cell-Mediated Cytotoxic Responses

Immunobiology: The Immune System in Health & Disease Sixth Edition Chapter 6 Signaling Through Immune System Receptors Copyright © 2005 by Garland Science.

Cytotoxic T Lymphocytes (CTLs) and NK Cells. After activation, naïve T cells differentiate into effector and memory T cells.

in out Lipid bilayer of plasma membrane Antigen recognition Signal transduction (contains one or more ITAMs) + - Src-family tyrosine kinase reversibly.

Ligand Receptor Cortisol Receptor is located in the cytosol Retinoid Receptors are in the nucleus Target gene in the nucleus Regulation of Transcription.

Manifestation of Novel Social Challenges of the European Union in the Teaching Material of Medical Biotechnology Master’s Programmes at the University.

Antigen presentation in a nutshell

Signal Transduction II Transduction Proteins & Second Messengers.

Student Research Interest HER2 Receptor Signaling in Breast Cancer Cells Marc Y. Fink Biomedical Sciences LIU-Post.

Gene Transcription G0G0 G1G1 Priming S G2G2 M Cell Cell Cycle Growth Factors + Growth Factors & Cell Cycle Receptors.

Advisor : Assoc. Prof. Dr. Chanvit Leelayuwat. Multi-risk factor of Atherosclerosis  Dyslipidemias - high of low-density lipoprotein cholesterol (LDL-C)

Immunobiology: The Immune System in Health & Disease Sixth Edition

Jianzhong Chen, Ph.D. Institute of Immunology, ZJU.

T Cells More functionally diverse than B cells CD4+ Respond to Ag in context of MHC II Provide helper functions TH1/TH2 A subset of CD4+ have regulatory.

B – CELL ACTIVATION Where and how do all these things take place?

Nanoscale Liposomal CD22  E12-siRNA Formulation as a Potent RNAi Therapeutic Against B-cell Precursor Acute Lymphoblastic Leukemia Fatih M. Uckun, M.D.,

Cross-talk among M , NK and cancer cells: M  cells help NK cells to attack tumor by stimulatory RAE-1 but escape from NK killing by inhibitory Qa-1 Zhigang.

MICR 304 Immunology & Serology Lecture 6 NK Cells, Lymphocytes Chapter 1.4 –1.17; 2.30 – 2.33 Lecture 6 NK Cells, Lymphocytes Chapter 1.4 –1.17; 2.30 –

Introduction to Signaling Networks Biophysics 6702, February 2013 Jonathan P Butchar

How to present a scientific paper Dr. Rebecca B. Riggins Department of Oncology, Georgetown University

Innate immunity Part Ⅰ overview of innate immunity Part Ⅱ innate immune cells Part Ⅲ functions of innate immunity.

PLC activation Ca++ flux NF-AT / NFkB nuclear localization protein tyrosine phosphorylation IL-2 production proliferation cytokine production TCR internalization.

Extracellular Environment. Extracellular Environment.

Manifestation of Novel Social Challenges of the European Union in the Teaching Material of Medical Biotechnology Master’s Programmes at the University.

Where and how do all these things take place?

ANTIGEN-SPECIFIC T – CELL ACTIVATION MHC – peptide complex (ligand)

Overview Events controlled by signaling

NEGATIVE REGULATION OF THE IMMUNE SYSTEM

CS1, a SLAM family receptor involved in immune regulation, is a therapeutic target in multiple myeloma André Veillette, Huaijian Guo Critical Reviews.

January 21, 2009 Penny Morel Natural Killer Cells January 21, 2009 Penny Morel

Natural Killer Cells Philipp Eissmann, Imperial College London, UK

Immune Receptors and Signal Transduction

Cellular Immune response

Signal transduction Cellular response

Activation and Function Of T and B cells

B Cell Receptor Signalling

IMMUN 441: Week 5 AC Quiz Section

Molecular regulation of mast cell activation

Approaching the Asymptote: 20 Years Later

Figure 2 Immune-escape mechanisms of CTCs in the peripheral blood

Natural killer cell receptors: new biology and insights into the graft-versus-leukemia effect by Sherif S. Farag, Todd A. Fehniger, Loredana Ruggeri, Andrea.

Isabel Barao, William J Murphy

Mechanisms of mast cell signaling in anaphylaxis

Molecular regulation of mast cell activation

BDNF and insulin signaling pathways activated by phytochemicals.

Nat. Rev. Nephrol. doi: /nrneph

Figure 2 Influence of fucosylation on IgG effector functions

Figure 3 Effect of sialylated glycoforms on IgG activity

Schematic view of Trk receptors signalling, showing the three major pathways involved in cell differentiation and survival. Schematic view of Trk receptors.

Nat. Rev. Rheumatol. doi: /nrrheum

Volume 9, Issue 19, (October 1999)

Jeffrey S Miller Experimental Hematology

How to present a scientific paper

Syk-coupled C-type lectins in immunity

Defective neutrophil rolling and transmigration in acute uremia

Coinhibitory Pathways in the B7-CD28 Ligand-Receptor Family

Rejuvenating Exhausted T Cells during Chronic Viral Infection

Volume 22, Issue 1, Pages 9-18 (January 2005)

Volume 32, Issue 2, Pages (February 2010)

Platelet-derived growth factor (PDGF) signalling pathway.

T Cell Anergy: Where It's LAT

Vanessa L. Ott, PhD, John C. Cambier, PhD

Brief Review – Growth Factors and Receptors

Presentation transcript:

Strategies of NK cell recognition NO ACTIVATION PROTECTION SELF TOLERANCE Normal cell MHC class I Inhibitory KIR/Ly49 Activating receptors + - Activating ligands NK cell

« stressed » cell MHC class I Inhibitory KIR/Ly49 Activating receptors Activating ligands NK cell ACTIVATION SENSITIVITY IMMUNE SURVEILLANCE + - Strategies of NK cell recognition

CD16 Act. KIR/Ly49 NCR Some NK cell activating receptors… Ab-coated targets m157 and what else? Virus Hemagglutinins, +? H60, Rae1, MULT1 MICA/B, ULBPs NK ITAM-bearing molecules (CD3 , FcR , KARAP/DAP12) YxxM-bearing molecules (DAP10) NKG2D  1 +  2 integrins Adhesion molecules

ECTMIC D D ITAM ITAM FcR  KARAP/DAP12 Signaling adaptors D YxxM DAP10 D ITAM ITAMITAM CD3 

Yxx Lx (6-8) Yxx L V V ITAM (Immunoreceptor Tyrosine-based Activation Motif)

from Vivier & Anfossi, Nature Rev. Immmol iNKR ILT-2 CD85j LILRB1

- HRWCCNKKNAVVMDQEPAGNRTVNREDS DEQDPQE VTYAQL NH CVFTQRKIT RPSQRPKTPPTDI IVYTEL PNAEP - SLVYLKKKQVPALPGNPDHREMGETLPEEVGEYRQPSGGSVPVSPGPPSGLEPTSSSPYNPPDLEEAAKTEAENT ITYSLL KHPEALDEETEHDYQNHI Fc  RIIb KIR2D TM

IxYxx LV S L Yxx Lx (6-8) Yxx LV ITAM (Immunoreceptor Tyrosine-based Activation Motif) ITIM (Immunoreceptor Tyrosine-based Inhibition Motif)

ITIM-mediated inhibition of NK cell activation Tyrosine phosphorylation - ITIM-bearing receptor SHP-1, SHP-2 ITAM-dependent receptor + Syk, ZAP70 Cell activation

Syk PI3K PI3,4,5P3 Akt Sos/RasGRP Raf Ras Vav2/3 Rac PAK1 MEK ERK CytotoxicityCytokine secretion +? Src-family members (e.g. p56lck) Grb2 SLP-76LAT Shc 3BP2 Grb2 SLP-76 Vav1 PLC  3BP2 PLC  IP3DAG Ca 2+ PKC SHP-1 SHP-2 SHP-1 SHP-2 SHIP

Balance of Inhibitory and Stimulatory Recognition Regulates NK Cells Stimulatory Ligands Self MHC Inhibitory Receptor Stimulatory Receptor + Class I Normal Cell -protected- NK Cell Class I - Transformation/ Infection Class I - NK cells lyse cells that lack self MHC class I IFN-  Class I + Transformation/ Infection Class I + NK cells lyse MHC I + cells that upregulate stimulatory ligands IFN- 