Presentation is loading. Please wait.

Presentation is loading. Please wait.

IP3-induced Ca2+ release and calmodulin

Similar presentations


Presentation on theme: "IP3-induced Ca2+ release and calmodulin"— Presentation transcript:

1 IP3-induced Ca2+ release and calmodulin
Laboratory of Physiology KULeuven Leuven, Belgium

2 Agonists IP3 Ca2+ IP3R I, II, III Plasma membrane associated:
Cytoskeletal proteins: Actin; MyosinII Ankyrin; Tallin; Vinculin 4.1N Agonists IP Ca2+ Plasma membrane associated: Homer-mGluR TRPs; RhoA-TRPC1 G Kinases and phosphatases: PKA; Fyn BANK- PTK IRAG-PKG FKBP12-Calcineurin PP1 Cytosolic proteins: Calmodulin; CaBP IRBIT CARP HAP1A-Htt IP3R I, II, III Intraluminal proteins: Chromogranins; Calnexin

3 Calmodulin inhibits IP3-induced Ca2+ release
A7r5 cells 70% IP3R1 CaM Control HBE cells 90% IP3R3 Control CaM A7r5 HBE

4 CaM at N-terminal site inhibits IP3 binding
Lbs-1: IP3- binding core ( ) aa 1-225 NH2 COOH ER CYT CaM Adkins et. al., 2000 Ca2+CaM Yamada et. al., 1995 Lin et. al., 2000 Ca2+CaM SII Recombinant ligand-binding domain of IP3R1 (LBS-1) Lbs-1 Lbs-1  1-225 1 581 W226 1-225

5 The inhibition is Ca2+ independent
EC50= 1.7µM Lbs-1His Lbs-1  1-225His 1 581 W226 Ca2+ CaM1234 10 µM CaM1234 Ca2+ CaM 10 µM apoCaM 5 µM Ca2+ control [3H]IP3 binding (%) 5 10 0.0 0.1 0.2 0.3 B/F Bound (nM)

6 CaM-binding sites in the N-terminal region are Ca2+ independent
F 1 159 1-5-10 70% IQ (site1) 76% IQ 53% IQ A B C D E F CaM Ca2+ A B C D E F CaM EGTA Ca2+ independent EC50  µM

7 In COS cells IICR is inhibited by CaM
and by CaM1234 0.5 1 100 ATP (µM ) 600 Control CaM CaM1234 400 Ca2+i (nM) 200 250 500 750 1000

8 In permeabilized L15 cells IICR is inhibited by CaM
and by CaM1234 L15 cells % 40 Ca2+ release vs A23187 (%) 50 60 70 80 90 100 IP3R1 IP3R3 control CaM CaM1234 1 2 3 4 5 [Ca2+] µM CaM is not the Ca2+ sensor for the inhibition of IICR

9 Endoplasmic reticulum Cytosol CaM
The Ca2+/CaM site in the coupling region is not involved in the CaM inhibition of IICR R1:PPKKFRDCLFKLCPMNRYSAQKQFWKAAKPGAN R2:PPKKFRDCLFKVCPMNRYSAQKQYWKAKQAKQG R3:PPKKFRDCLFKVCPMNRYSAQKQYWKAKQTKQD 13 18 31 25 Endoplasmic reticulum Cytosol CaM W1577A (Zhang et al, 2001; Nosyreva et al, 2002) R1:LDSQVNNLFLKSHN-IVQKTAMNWRLSARN-AARRDSVLA R2:LDSQVNTLFMKNHSSTVQRAAMGWRLSARSGPRFKEALGG R3:LDAHMSALLSSGGSCSAAAQRSAANYKTATRTFPRVIPTA Ca2+/CaM

10 CONCLUSION: The N-terminal Ca2+-independent CaM-binding site is responsible for the CaM inhibition of IICR Significance ? 1) Interaction site for other CaM-like proteins ? 2) Involved in intramolecular interactions?

11 CaM or other CaM-like Ca2+ sensor proteins ?
Interaction with neuronal Calcium Binding Proteins (CaBP) Adapted from Haeseleer et al., 2000 Inhibitory Activatory ? (Yang et al., 2002)

12 CaBP1 binds to the N-terminal part of the IP3R
NH2 COOH ER CYT IP3 binding core ( ) aa 1-225 CaM CaBP1 ? Ca2+CaM CaBP1 GST 1-581 1-225

13 CaBP1 binds to a similar region as CaM
independently of Ca2+ A) 1 CaM CaM 159 A C D B E F B) + Ca2+ -Ca2+/ EGTA sCaBP1 C D F A B E sCaBP1 C D F A B E

14 Both long and short CaBPs
inhibit IP3-induced calcium release in COS-1 cells 45Ca2+ flux Control 200 400 600 800 1000 sCaBP lCaBP 0.5µM 1µM 100µM ATP Time (s) Ca2+i (nM)

15 CaBP inhibits IP3-induced Ca2+ release independent of Ca2+ binding
EF1 EF2 EF3 EF4 YFP 1000 800 600 400 200 1500 500 Time (s) [Ca2+ ]i (nM) 0.5 1 100 µM ATP Control CaBP134

16 Significance ? 1) Interaction site for other CaM-like proteins ?
2) Involved in intramolecular interactions?

17 Suramin interacts with the CaM-binding sites on IP3R1
Suramin mimics the CaM inhibition of IICR Control 100 µM suramin 1-225 EGTA Ca 2+ IP3R1 Input Seph CaM-Seph + Suramin Control 10 µM CaM

18 N-terminal CaM-binding site = intramolecular interaction site?
Suramin CABP1 CaM1234 Interaction with IBC GST / IP3 AdPhos CaM sCaBP-1 IP3 binding core (IBC) CaM NH2 COOH ER CYT 1-->225 Ca2+CaM

19 In permeabilized A7r5 cells
Suramin induced a large IP3-independent Ca2+ release

20 New type of Ca2+ -induced Ca2+ release (CICR) channel ??
+ CaM1234

21 Characteristics of the CICR mode
Ca2+ dependence: EC50 = 700 nM Hill = 1.9 Mg2+ inhibition: EC50= 0.6 mM ATP stimulation: EC50= 320 µM

22 Effects of CaM, CaM1 and CaM1234
40 30 20 Fractional loss (%/ 2 min) 10 10 20 Time (min) control CaM1 CaM CaM1234

23 Calmodulin Calmodulin Calmodulin NCS - 1/Frequenin Short CaBP1 1/FrequeninE120Q Calmodulin1 Calmodulin1 Calmodulin1234 Long CaBP1 NCS - 1/Frequenin Short CaBP1 1/FrequeninE120Q Calmodulin1234 Calmodulin1234 Long CaBP1 Long CaBP1 Short CaBP1 NCS - 1/Frequenin NCS - 1/FrequeninE120Q

24 Preincubation with a CaM-binding peptide inhibits CICR
control RyR1 CaM-BS (peptide aa ) Ca2+ (3 µM)

25 CaM but not CaM1234 can restore CICR
Preincubation with RyR1 CaM-BS (peptide aa ) CaM Ca2+ (3 µM)

26 CaM but not CaM1234 can restore CICR
Preincubation with RyR1 CaM-BS (peptide aa ) CaM1234 CaM Ca2+ (3 µM)

27 New type of Ca2+ -induced Ca2+ release channel ??
CONCLUSIONS Mg2+ - CaM1234 Inhibited by CaM mutants Inhibited by CaM-like proteins CICR channel Ca2+ + ATP suramin CaM is the Ca2+ sensor CaM IP3R CICR New type of intracellular Ca2+ channel (Wissing et al, 2002)? Related to polycystin-2 (Koulen et al., 2002)? Related to TRPV1 (Liu et al., 2003)? Truncated IP3R?

28 Baylor College of Medicine Houston, Texas
KULeuven Leuven, Belgium Babraham Institute Cambridge UK Jan B. PARYS Geert CALLEWAERT Ludwig MISSIAEN Rafael A. FISSORE Nael NADIF KASRI Geert BULTYNCK Karolina SZLUFCIK Leen VERBERT Elke VERMASSEN Zerihun ASSEFA Iris CARTON Patrick DE SMET H. Llewelyn Roderick Martin D. Bootman Michael Berridge Baylor College of Medicine Houston, Texas Andreas Jeromin The Division of Molecular Neurobiology The Institute of Medical Science The University of Tokyo Katsuhiko Mikoshiba


Download ppt "IP3-induced Ca2+ release and calmodulin"

Similar presentations


Ads by Google