1. (Approved investigational)
Drugbank ID : DB00113
Protein average weight :

2. Half life : Approximately 1 hour Description :
Reduced Fab fragment of the murine IgG1 monoclonal antibody IMMU-4 (also called NP-4) with specificity for carcinoembryonic antigen (CEA) covalently labeled with Technitium 99. The molecule has a molecular weight of ~54,000 Daltons.
Indication :
For imaging colorectal tumors
Pharmacodynamics :
Binds to the carcinoembryonic antigen, which is a cell surface protein generally overexpressed in colon (and other) cancers. The radioactive Tc99, which is covalently attached to the antibody, allows radiodiagnostic detection of CEA expressing cells and tumors

3. Metabolism : Most likely removed by opsonization via the reticuloendothelial system, or by human antimurine antibody production
Mechanism of action :
Binds selectively to cell-surface carcinoembryonic antigen (CEA) expressed on colorectal tumors.

4. Targets : Affected organisms :
Carcinoembryonic antigen-related cell adhesion molecule 1
Affected organisms :
Humans and other mammals

5. Categories :
Diagnostic Agents
Sequence :
>1clo:Anti-CEA heavy chain 1
EVKLVESGGGLVQPGGSLRLSCATSGFTFTDYYMNWVRQPPGKALEWLGFIGNKANGYTT
EYSASVKGRFTISRDKSQSILYLQMNTLRAEDSATYYCTRDRGLRFYFDYWGQGTTLTVS
SAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQS
DLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCPPCKCPAPNLLGGPSVF
IFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLR
VVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKK
QVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERN
SYSCSVVHEGLHNHHTTKSFSR
>1clo: Anti-CEA antigen light chain 1
QTVLSQSPAILSASPGEKVTMTCRASSSVTYIHWYQQKPGSSPKSWIYATSNLASGVPAR
FSGSGSGTSYSLTISRVEAEDAATYYCQHWSSKPPTFGGGTKLEIKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>1clo:Anti-CEA heavy chain 2
>1clo: Anti-CEA antigen light chain 2

6. Brands : CEA-Scan
Company : Immunomedics Inc
Description : CEA is expressed by more than 90% of colorectal cancers, as well as by a large number of other carcinomas, including esophageal, stomach, lung, breast, pancreas, uterus, and ovarian cancer. It has been shown that this tumor marker can serve as a useful target for radiolabeled antibodies. Since CEA-Scan uses a small antibody fragment at a low dose, there is virtually no immune reaction by subjects to the foreign protein. In addition, linking the fragment with technetium-99m, a common radioisotope in nuclear medicine, permits tumor detection within a few hours, using conventional gamma cameras.
Used for/Prescribed for : CEA- Scan is used for treating colorectal cancer.

7. Allergic reaction, mild, transient (itching; skin rash),bursitis (pain and inflammation at the joints),eosinophilia, transient, fever , headache, nausea.