1. Palifermin Drugbank ID : DB00039
Protein chemical formula : C721H1142N202O204S9
Protein average weight :

2. Description : Indication : Pharmacodynamics :
Palifermin is a recombinant human keratinocyte growth factor (KGF). It is 140 residues long, and is produced using E. coli.
Indication :
For treatment of oral mucositis associated with chemotherapy and radiation therapy.
Pharmacodynamics :
Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs.

3. Mechanism of action :
Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival.

4. Drug Interaction: Targets : Affected organisms :
Bendamustine
Increases toxicity of bendamustine. Should not be administered within a 24 hour time period of antineoplastic agent administration.
PralatrexateIncreases the toxicity of pralatrexate. Avoid concomitant therapy or do not use palifermin within 24 hours after administration of pralatrexate.
Targets :
Fibroblast growth factor receptor 2,Neuropilin-1,Fibroblast growth factor receptor 1,Fibroblast growth factor receptor 4,Fibroblast growth factor receptor 3,Basement membrane-specific heparan sulfate proteoglycan core protein
Affected organisms :
Humans and other mammals .

5. Categories : Sequence : Anti-Mucositis Agents
SYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

6. Brands : Kepivance
Company : Amgen Inc
Description : Kepivance (palifermin) is a manmade form of a human protein that affects growth of cells within the tissues lining your mouth and digestive tract (esophagus, stomach, and intestines).
Used for/Prescribed for : Kepivance is used to help prevent or heal mouth sores and ulcers in people being treated with chemotherapy and stem cell treatment. Kepivance is used in people receiving chemotherapy to treat blood cancers (Hodgkin's disease, multiple myeloma, leukemia).
Form : sterile, lyophilized powder
Route of administration : intravenous injection

7. Dosage : The recommended dose of Kepivance is 60 mcg/kg/day, administered as an intravenous bolus injection for 3 consecutive days before and 3 consecutive days after myelotoxic therapy, for a total of 6 doses. Side effects : fever; swelling or redness of your skin; itching or rash; changes in your sense of taste or sense of touch; Drug interaction : A total of 100 drugs (234 brand and generic names) are known to modereately interact with Kepivance (palifermin).

8. References : http://www. fda