Presentation is loading. Please wait.

Presentation is loading. Please wait.

Sequence File Formats.

Similar presentations


Presentation on theme: "Sequence File Formats."— Presentation transcript:

1 Sequence File Formats

2 Sequence File Formats Different formats for different uses
Competing formats developed in parallel Some easy to read, some easy to write programs Don’t have to stick to these formats, but parsers already written! Most formats are plain text (not .bam files!)

3 Id’s versus accessions
When people first started, they were using gene names as id’s But too few gene names, and databases require unique ids Now have a variety of accession numbers The simplest id is a number that you increment, as you can (almost) never run out of IDs.

4 Standard genetic code Symbol Meaning Origin G Guanine A Adenine C
Cytosine T Thymine R G or A puRine Y T or C pYrimidine M A or C aMino K G or T Keto N G or A or T or C aNy

5 Standard protein codes
One Three Amino acid A Ala Alanine M Met Methionine C Cys Cysteine N Asn Asparagine D Asp Aspartic acid P Pro Proline E Glu Glutamate R Arg Arginine F Phe Phenylalanine S Ser Serine G Gly Glycine T Thr Threonine H His Histidine V Val Valine I Ile Isoleucine W Trp Tryptophan K Lys Lysine Y Tyr Tyrosine L Leu Leucine X Xaa Unknown

6 Fasta Simplest file format. Easy to parse, easy to use
>identifier [optional information] ATGACTAGCATGCATCGATCGATCGACTAGCAT G ACTGCACTACGACGACAGCAAC >identifier2 [optional information] ACTAGCTCAGCTAGAGAGCTACGATCAGCACTA C atccgatagcatgacttactACGCTAGCATCAG TCATACAT

7 GenBank More complex, includes detailed information on genes, cds, annotation etc Human readable Difficult to parse Use standard parsers (bioperl, biojava, etc)

8 LOCUS NC_001418 5833 bp ss-DNA circular PHG 17-APR-2009
DEFINITION Pseudomonas phage Pf3, complete genome. ACCESSION NC_001418 VERSION NC_ GI: DBLINK Project:14061 KEYWORDS . SOURCE Pseudomonas phage Pf3 ORGANISM Pseudomonas phage Pf3 Viruses; ssDNA viruses; Inoviridae; Inovirus. FEATURES Location/Qualifiers source /organism="Pseudomonas phage Pf3" /mol_type="genomic DNA" /host="Pseudomonas aeruginosa" /db_xref="taxon:10872" /note="Pf3 bacteriophage DNA from P.aeruginosa infected with plasmid RP1." gene join( ,1..106) /locus_tag="Pf3_1" /db_xref="GeneID: " CDS join( ,1..106) /note="orf 58, part 2" /codon_start=1 /transl_table=11 /product="hypothetical protein" /protein_id="NP_ " /db_xref="GI: " /translation="MSYYVCVQLVNDVCHEWAERSDLLSLPEGSGLQIGGMLLLLSAT AWGIQQIARLLLNR"

9 3241 aggtcctgtt ggccttaaga tcacccaagg gcatcttgcc agatggtacc gtcattactt
3301 atgagaaaat atcctcaatg ggtaatggct ataccttcga gcttgagtcg cttatatttg 3361 cggctcttgc tcggtcttta tgcgaattac tgggcttacg accgtcagat gttacggtct 3421 atggcgatga cataatattg ccatcagacg cgtgcagtcc tctagttgaa gttttctcct 3481 atgttggttt tcgtaccaac aagaagaaaa cgttttctag tggaccgttc cgagagtcgt 3541 gcggaaagca ctactttttg ggcgttgacg tcacaccttt ctacatacgt cgccgtatag 3601 tgagtccctc cgatctcata ctggttttga accagatgta tcgttgggcc acaattgacg 3661 gcgtatggga tcctagggta tatcctgtat acaccaagta tagacgttac cttccggaaa 3721 ttctccggag gaatgtcgtg cctgatggat acggtgatgg tgccctcgtc ggatctgtct 3781 taatcagtcc tttcgcagaa aatcgcggtt gggttcggcg tgtgccgatg attatagaca 3841 agaggaaaga ccgagttcgt gacgaatatg gttcgtatct ctacgagcta tggtcgttgc 3901 agcaactcga atgtgacagt gagttcccct ttaacgggtc gctggtcgtt ggttccactg 3961 atggcactct cgcttacgca caccgagaac ggttacctac cgttatcagt gatgccgtaa 4021 gtgcgtttga catcatgtgg ataccgtgca gtagtcgtgt cctggctccc tacggggatt 4081 tccggaggca cgaaggctct atcctaaaaa tggggtagcg cctgggaggg gtgcattatg 4141 caccctaggt tagcaatact taaactaacc ttctcaaaag agagagtgaa ggctctgctt 4201 tgccctcact cctccca // LOCUS NC_ bp ds-RNA linear PHG 23-AUG-2008 DEFINITION Pseudomonas phage phi8 segment S, complete sequence. ACCESSION NC_003301 VERSION NC_ GI: DBLINK Project:14731 KEYWORDS . SOURCE Pseudomonas phage phi8 ORGANISM Pseudomonas phage phi8 Viruses; dsRNA viruses; Cystoviridae; Cystovirus.

10 GFF3 Tab separated format Easy to parse
Columns: Contig Source database Feature type Start Stop Score Strand Phase Attributes Tab separated format Easy to parse Attributes are tag/value pairs separated by “;”

11 ASN.1 Developed as computer readable form of GenBank Not widely used

12 ASN.1 seq { id { local id 1 }, descr { title "" }, inst {
repr raw, mol aa, length 131, topology linear, { seq-data iupacaa "TSPASIRPPAGPSSRPAMVSSRRTRPSPPGPRRPTGRPCCSAAPRRPQA TGGWKTCSGTCTTSTSTRHRGRSGWSARTTTAACLRASRKSMRAACSRSAGSRPNRFA PTLMSSCITSTTGPPAWAGDRSHE" } } , iupacaa "TSPASIRPPAGPSSR RPSPPGPRRPTGRPCCSAAPRRPQAT GGWKTCSGTCTTSTSTRHRGRSGW RASRKSMRAACSRSAGSRPNRFAPTL MSSCITSTTGPPAWAGDRSHE" } }

13 Base calling Need to be sure which base you have identified
Depends on the technology Each machine includes software Phred is an historical package developed by at U. Washington Phred scores are probability that the base is correct 13

14 Quality values Phred 10: 1 x 101 chance that the base is wrong
Phred 99: the base is correct! Fastq scores are the score + 33 then converted to ascii text 14

15 FastQ Based on fasta format
Contains information about the quality of the sequence Quality comes from sequencing machines! Four lines per sequence: Line = identifier line before the sequence DNA sequence Line starting + = identifier line before the quality scores String = quality scores as ASCII + 33

16 ASCII character codes ASCII Char 33 ! 50 2 70 F 90 Z 110 n 34 " 51 3
71 G 91 [ 111 o 35 # 52 4 72 H 92 \ 112 p 36 $ 53 5 73 I 93 ] 113 q 37 % 54 6 74 J 94 ^ 114 r 38 & 55 7 75 K 95 _ 115 s 39 ' 56 8 76 L 96 ` 116 t 40 ( 57 9 77 M 97 a 117 u 41 ) 58 : 78 N 98 b 118 v 42 * 59 ; 79 O 99 c 119 w 43 + 60 < 80 P 100 d 120 x 44 , 61 = 81 Q 101 e 121 y 45 - 62 > 82 R 102 f 122 z 46 . 63 ? 83 S 103 g 123 { 47 / 64 @ 84 T 104 h 124 | 48 65 A 85 U 105 i 125 } 49 1 66 B 86 V 106 j 126 ~

17 fastq DNA sequence @SRR014849.1 EIXKN4201CFU84 length=93
GGGGGGGGGGGGGGGGCTTTTTTTGTTTGGAACCGA AAGGGTTTTGAATTTCAAACCCTTTTCGGTTTCCAA CCTTCCAAAGCAATGCCAATA +SRR EIXKN4201CFU84 length=93 Quality scores Note: Illumina has a format of fastq that is not compatible with everyone else’s format!

18 How to convert fastq to fasta
prinseq-lite.pl -fastq input.fastq -out_format 2


Download ppt "Sequence File Formats."

Similar presentations


Ads by Google