Presentation is loading. Please wait.

Presentation is loading. Please wait.

В.A.Рихтер Пептид молока человека – лактаптин, как потенциальный противораковый препарат Москва, 2013.

Similar presentations


Presentation on theme: "В.A.Рихтер Пептид молока человека – лактаптин, как потенциальный противораковый препарат Москва, 2013."— Presentation transcript:

1 В.A.Рихтер Пептид молока человека – лактаптин, как потенциальный противораковый препарат Москва, 2013

2 Lactaptin purification from human milk
In vivo study (clinical trial) disadvantages APOPTIN Multiple myeloma TRAIL-based proteins (anti-TRAIL-receptor mAb and recombinant TRAIL) Mapatumumab: non-Hodgkin’s lymphoma, colorectal, ovarian, prostate cancer; Lexatumumab: advanced solid tumors. Narrow range of constitutively TRAIL-sensitive tumors ER-specific mAb Herceptin- Breast cancer Rituximab- B-cell lymphoma ER-dependent spectrum of tumors MDA-7 Advanced carcinomas, melanomas Resistance of pancreatic and colorectal cancer Alfa-lactalbumin +5 molecules of oleic acid (HAMLET, BAMLET) Papillomatous skin tumor, bladded cancer, glioma Restricted spectrum of tumors (need for local administration)

3 Human k-casein, lactaptin and recombinant analogue RL2
GGSHHHHHH Lactaptin 8.6 kDa NH2 182 COOH 23 57 134 Human kappa-casein YYGTNLYQRRPAIAINNPYVPRTYYANPAVVRPHAQIPQRQYLPNSHPPTVVRRPNLHPSFIAIPPKKIQDKIII

4 RL2 cytotoxicity in vitro
Cultured human cells Primary human cells

5 Sensitivity of mice cancer cells to RL2
Cell line IC50, μg/mL hepatoma 22 100 MX-82 hepatoma A1 (HA1) 8 L-1210 180 MX-7 170 Ehrlich carcinoma Lewis carcinoma 190

6 Study design Tumor cells inoculation Tumor growth RL2 therapy
Control group RL2 therapy i.v. injection s.p. injection

7 The dose effect of RL2 on the growth rate of HA-1 tumors
* ** Statistical differences in mean tumor weight between control and experimental groups are indicated by * for p < 0.01; ** for p < 0.05 (statistically significant differences between groups).

8 Course-dependent antitumor activity of RL2
** * RL2 delays the formation of primary HA1 tumor

9 Metastasis suppression effect of RL2
control RL2 therapy P<0,001 A/Sn female mice were s.c. injected with 5x105 hepatoma HA-1 cells. RL2 (1 mg) was injected i.v. 5 times. Liver metestases

10 Postsurgical metastasis model
A/Sn mice were i.v. injected with 2x105 hepatoma HA1 cells. Two days later RL2 (1 mg) was injected i.v. for 4 days.

11 RL2RL2 inhibition of MDA-MB-231 tumor growth in SCID mice

12 RL2 enhances antitumor effect of cyclophosphamide
A/Sn female mice (5 in group) were i.p. inoculated with 2x106 hepatoma HA-1 cells. Next day mice were i.p. treated with RL2 (0.5 mg/dose) and cyclophosphamide (30 mg/kg). Therapeutic course consisted of 5 injections.

13 RL2 suppresses tumor growth and metastases: comparison with TNFa
- Tumor cell inoculation - Repetitive RL2/TNFa injections - Tumor growth and metastases progression - Surgical removal of the tumor - Survival upon metastases response

14 what is the mechanism of action
LACTAPTIN - induces apoptosis in cancer cells in vitro - Inhibits tumor growth in vivo what is the mechanism of action

15 Accumulation and distribution of RL2-Rh conjugate into MCF-7 and MSC cells
Fluorescent microscopy of DAPI stained cells

16 Confocal microscopy of MCF-7 cells with RL2-Rh conjugate
Staining DAPI (nucleus) Cell Tracker Green (cytoplasm) RL2-Rhodamin

17 Effect of RL2 on mitochondria membrane potential (HA1 cells)
Study design Effect of RL2 on mitochondria membrane potential (HA1 cells) - control - RL2 control Cell number + RL2 JC-1 staining

18 Mitochondrial apoptotic pathway activation by RL2
O h 4 h 48 h A - control; B - RL2-treated cells. The apoptotic changes in MCF-7 cells after RL2 treatment (4h) were detected as a shift of Δψ Early apoptotic transition of TMP was analyzed by flow cytometry of DiOC6/PI stained MCF-7 cells

19 RL2 activates procaspases 8 and 9 in MCF-7 cells

20 Caspase 7 activity in MCF-7 cells
control RL2 Western blot analysis of caspase 7 activity 1- mass marker 2- control cells 3- RL2-treated cells Population with active caspase 7

21 Transcriptional response of MCF-7 cells on RL2 treatment
Functional groups of genes p-value Gene number Centromeric regions 1.21E-05 11 Microtubule cytoskeleton organization 3.06E-04 14 Actin cytoskeleton organization 3.83E-03 Regulation of mitotic cell cycle 1.53E-03 DNA damage response, signal transduction of p53 class mediator 9.40E-03 6 Data of НТ-12 (Illumina)-analysis

22 RL2 interacts with cell proteins α-and β-chains of tubulin,
Identification by SwissProt database Affine chromatography of МСF-7 cells lysates electrophoresis trypsinolysis α-and β-chains of tubulin, α-actinin-1

23 Apoptosis pathway inducing by RL2

24 Work was supported by: RFBR10-04-01109-а; 11-04-12100; 13-04-01313
Our team: Olga Koval Alexandr Fomin Miraslava Potapenko Elena Kuligina Dmitry Semenov Vivarium ICG SB RAS Vasily Kaledin Valery Nikolin Histology Eugeny Nikitenko Work was supported by: RFBR а; ; FTP № and 16.N

25 Expression of apoptosis-related molecules
The expression levels of apoptosis-related molecules, such as Bcl-2, p53 and MDM2 in RL2-treated MDA-MB-231 cells were analyzed by Western blot. We observed that during RL2 treatment p53-cleaved protein level decreased and p53 held in active form. Active p53 able to decreases Bcl-2 protein level that can be seen in the blot. Moreover, analysis of MDM2 level in MDA-MB-231 cells shows the appearance of MDM2 cleaved form. Together, these data could indicate that RL2-dependent apoptosis in MDA-MB-231 cells was accompanied by p53 stabilization and Bcl-2 depletion.


Download ppt "В.A.Рихтер Пептид молока человека – лактаптин, как потенциальный противораковый препарат Москва, 2013."

Similar presentations


Ads by Google