Presentation is loading. Please wait.

Presentation is loading. Please wait.

Figure 1. Variable region amino acid sequences of TPO-reactive Fab heavy chains. The putative most homologous germline sequence is shown in full, with.

Published byJeffry Hawkins Modified over 6 years ago

Similar presentations

Presentation on theme: "Figure 1. Variable region amino acid sequences of TPO-reactive Fab heavy chains. The putative most homologous germline sequence is shown in full, with."— Presentation transcript:

1 Figure 1. Variable region amino acid sequences of TPO-reactive Fab heavy chains. The putative most homologous germline sequence is shown in full, with amino acid mismatches of Fab heavy chains indicated. CDR regions are shown in bold type. Alignments are shown for V<sub>H</sub>1 heavy chains (a) and V<sub>H</sub>3 heavy chains (b). Germline V regions are from Ref. 17, except DP-58 (19). The following have identical V region amino acid sequences; 126TO3H (shown), 7H, and 14H; 126BH (shown), IH, 126TO9H, and 126TP7H; 126TP10H (shown) and 15H; and 131TP2H (shown), 6H, 11H, and 15H. Analysis of Immunoglobulin Gκ Antithyroid Peroxidase Antibodies from Different Tissues in Hashimoto’s Thyroiditis1 J Clin Endocrinol Metab. 1997;82(11): doi: /jcem J Clin Endocrinol Metab | Copyright © 1997 by The Endocrine Society

2 Figure 2. Junction region amino acid sequences of TPO-reactive Fab heavy chains. The putative most homologous germline D and J sequences are shown in full, with amino acid mismatches of TPO-reactive Fab heavy chains indicated. CDR regions are shown in bold type. Alignments are shown for V<sub>H</sub>1 heavy chains (a) and V<sub>H</sub>3 heavy chains (b). Germline D regions are from D21–10 (20), D5/D5a (21), DK1 (22), and D3 and D2 (23). Germline J regions are from Ref. 24. The following have identical D/J region amino acid sequences; 126TO3H (shown), 7H, and 14H; 126TO1H (shown) and 126TP13H; 126AH (shown) and GH; 126BH (shown), IH, and 126TP10H; and 131TP2H (shown), 5H, 6H, 7H, 8H, 11H, and 15H. Analysis of Immunoglobulin Gκ Antithyroid Peroxidase Antibodies from Different Tissues in Hashimoto’s Thyroiditis1 J Clin Endocrinol Metab. 1997;82(11): doi: /jcem J Clin Endocrinol Metab | Copyright © 1997 by The Endocrine Society

3 Figure 3. Variable region amino acid sequences of TPO-reactive Fab κ-chains. The putative most homologous germline sequence is shown in full, with amino acid mismatches of Fab κ-chains indicated. CDR regions are shown in bold type. Alignments are shown for V<sub>κ</sub>1 κ-chains (a) and V<sub>κ</sub>3 κ-chains. Germline variable regions are from Ref. 18, except K9 (25). The following have identical V region amino acid sequences; 126TP5K (shown), 9K, and 14K; 126TO2K (shown), 3K, 7K, and 14K; 126TO1K (shown), 126TP15K, 131TP2K, and 11K; 131TP5K (shown), 7K, 8K, and 15K; 126CK (shown) and FK; 126AK (shown), BK, IK, JK, and 126TP1K; and 126TP8K (shown) and 10K. Analysis of Immunoglobulin Gκ Antithyroid Peroxidase Antibodies from Different Tissues in Hashimoto’s Thyroiditis1 J Clin Endocrinol Metab. 1997;82(11): doi: /jcem J Clin Endocrinol Metab | Copyright © 1997 by The Endocrine Society

4 Figure 4. Junction region amino acid sequences of TPO-reactive Fab κ-chains. The putative most homologous germline J sequence is shown in full, with amino acid mismatches of TPO-reactive Fab κ-chains indicated. CDR regions are shown in bold type. Germline J regions are from Ref. 26. The following have identical J region amino acid sequences; 131TP5K (shown), 7K, 8K, and 15K; 131TP2K (shown), 6K, and 11K; 126AK (shown), BK, CK, DK, FK, HK, IK, JK, 126TP1K, 6K, 7K, 8K, 10K, 13K, 15K, and 126TO10K; 126TO2K (shown), 3K, 7K, 14K, 126TP5K, 9K, and 14K; and 126GK (shown) and 126TO8K. Analysis of Immunoglobulin Gκ Antithyroid Peroxidase Antibodies from Different Tissues in Hashimoto’s Thyroiditis1 J Clin Endocrinol Metab. 1997;82(11): doi: /jcem J Clin Endocrinol Metab | Copyright © 1997 by The Endocrine Society

5 Figure 5. Inhibition of TPO Ab binding from the serum of five patients with HT by TPO-reactive Fab. TPO Ab binding was determined in the presence of no Fab, a single Fab, or two Fab. Examples are shown from HT126 serum (Fab1 = 126B, Fab2 = 126TP13), serum 1 (Fab1 = 126TO10, Fab2 = 131TP2), serum 2 (Fab1 = 126TO10, Fab2 = 131TP7), serum 3 (Fab1 = 126B, Fab2 = 131TP2), and serum 4 (Fab1 = 126B, Fab2 = 131TP15). Analysis of Immunoglobulin Gκ Antithyroid Peroxidase Antibodies from Different Tissues in Hashimoto’s Thyroiditis1 J Clin Endocrinol Metab. 1997;82(11): doi: /jcem J Clin Endocrinol Metab | Copyright © 1997 by The Endocrine Society

Download ppt "Figure 1. Variable region amino acid sequences of TPO-reactive Fab heavy chains. The putative most homologous germline sequence is shown in full, with."

Similar presentations

Lecture 2 Antigens, Receptors and Immunoglobulins.

Lecture 2 Antigens, Receptors and Immunoglobulins.
MLRS 242 Immunology Pat Reed Antibodies

MLRS 242 Immunology Pat Reed Antibodies
Antibody structure & function Lecture 9 13/10/2015.

Antibody structure & function Lecture 9 13/10/2015.
MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.
Figure 1. Mass of rapid insulin secretory bursts and ApEn values in young and old subjects. Increased Disorderliness of Basal Insulin Release, Attenuated.

Figure 1. Mass of rapid insulin secretory bursts and ApEn values in young and old subjects. Increased Disorderliness of Basal Insulin Release, Attenuated.
Figure 2. ROC curves for fasting values (A) and OGTT values (B) for detecting insulin resistance in PCOS women. Sensitivity is plotted against 1 − specificity.

Figure 2. ROC curves for fasting values (A) and OGTT values (B) for detecting insulin resistance in PCOS women. Sensitivity is plotted against 1 − specificity.
M protein detection and characterization

M protein detection and characterization
IMMUNOGLOBULIN STRUCTURE AND GENES THAT CODE FOR THEM

IMMUNOGLOBULIN STRUCTURE AND GENES THAT CODE FOR THEM
Figure 2. Summary of trial events

Figure 2. Summary of trial events
(Adapted, with permission, from Fagin JA

(Adapted, with permission, from Fagin JA
Figure 1. Twenty-four-hour plasma ACTH concentrations in insomniacs (▪) and controls (○). The thick black line indicates the sleep recording period. The.

Figure 1. Twenty-four-hour plasma ACTH concentrations in insomniacs (▪) and controls (○). The thick black line indicates the sleep recording period. The.
Fig. 1. Schematic representation of ProCT and the other CT precursors (CTpr) derived from this prohormone (i.e. NProCT, CT-CCP-I, and CCP-I). The mean.

Fig. 1. Schematic representation of ProCT and the other CT precursors (CTpr) derived from this prohormone (i.e. NProCT, CT-CCP-I, and CCP-I). The mean.
Circadian Rhythms of Women with Fibromyalgia1

Circadian Rhythms of Women with Fibromyalgia1
Figure 1. Schematic representation of TSHR

Figure 1. Schematic representation of TSHR
Fig. 1. Mean BMI and BMI Z-score (se) of the children with AA, TA, and TT genotypes in rs9939609 of the FTO gene. The P values are for the additive model.

Fig. 1. Mean BMI and BMI Z-score (se) of the children with AA, TA, and TT genotypes in rs of the FTO gene. The P values are for the additive model.
Fig. 1. Correlation of TSH with TC, LDL-C, HDL-C, and TG.

Fig. 1. Correlation of TSH with TC, LDL-C, HDL-C, and TG.
Fig. 1. Study enrollment and disposition of participants

Fig. 1. Study enrollment and disposition of participants
Nat Clin Pract Endocrinol Metab 3: 279–289 doi: /ncpendmet0447

Nat Clin Pract Endocrinol Metab 3: 279–289 doi: /ncpendmet0447
Nat. Rev. Endocrinol. doi: /nrendo

Nat. Rev. Endocrinol. doi: /nrendo
Figure 1. Circadian pattern of gastric pH in healthy control subjects documented before (P1) Ramadan, on the 10th day (P2) and on the 24th day (P3) of.

Figure 1. Circadian pattern of gastric pH in healthy control subjects documented before (P1) Ramadan, on the 10th day (P2) and on the 24th day (P3) of.

Similar presentations

Ads by Google