1. EUChinaGRID Applications
Fabio Polticelli
Computational Biochemistry Lab - University Roma Tre
EUChinaGRID WP4-Applications Manager
Budapest,

2. “Pilot” applications EGEE ARGO NBP Application ATLAS and CMS support
Data mover
MEDEA++
Corsika
NBP Application
Rosetta
Early/Late Stage

3. Deployment of CMS and ATLAS applications on EUChinaGRID pilot infrastructure
EGEE applications
The Large Hadron Collider (LHC), currently being built at CERN near Geneva, is the largest scientific instrument on the planet. When it begins operations in 2007, it will produce roughly 15 Petabytes (15 million Gigabytes) of data annually, which thousands of scientists around the world will access and analyse.
ATLAS (A Toroidal LHC ApparatuS) is one of the five particle detector experiments (ALICE, ATLAS, CMS, TOTEM, and LHCb) being constructed at the Large Hadron Collider, a new particle accelerator at CERN in Switzerland. It will be 45 metres long and 25 metres in diameter, and will weigh about 7,000 tonnes. The project involves roughly 2,000 scientists and engineers at 151 institutions in 34 countries. The construction is scheduled to be completed June, The experiment is expected to measure phenomena that involve highly massive particles which were not measurable using earlier lower-energy accelerators and might shed light on new theories of particle physics beyond the Standard Model.
The Compact Muon Solenoid (CMS) experiment is one of two large general-purpose particle physics detectors being (as of 2006) built on the proton-proton Large Hadron Collider (LHC) at CERN in Switzerland. Approximately 2300 people from 159 scientific institutes form the collaboration building it. It will be located in an underground chamber at Cessy in France, just across the border from Geneva. The completed detector will be cylindrical, 21 metres long and 16 metres diameter and weigh approximately tonnes. CMS is designed as a general-purpose detector, capable of studying many aspects of proton collisions at 14 TeV, the center-of-mass energy of the LHC particle accelerator. It contains subsystems which are designed to measure the energy and momentum of photons, electrons, muons, and other products of the collisions.

4. ARGO applications ARGO-YBJ experiment data transfer
Large data sets (250 TBytes/year) to be stored and shared by European and Chinese partners.
ARGO-YBJ Data Mover.
Deploy the applications on the pilot infrastructure
Analysis of the data to study gamma ray bursts
MEDEA++
Corsika
ARGO applications

5. Biological applications
Generate “never born protein” sequences database
Port protein structure prediction software on grid
Develop web tools for non grid trained users
Biological applications
KWCWPFASHNDLKVQSQWYVEPPDTIPPYNKYGTNFIKHCQYIAHMQGDTHFFNRVRMHQLWKIIVDCAY
Rosetta
Early/Late Stage

6. New applications New applications “presented” by existing partners
Realm of the applications enriched by new themes
Ranked and selected according to common agreed criteria
Porting strategy involving a school on application porting
Beijing, October 25th - November 3rd
Task force made by partners
New applications

7. Applications Categorization
Applications categorized by scientific/technical field
Biological applications (2 new)
Structural biology
Genomics
Drug discovery
High energy physics applications
Astrophysics applications (3 new)
Engineering applications (2 new)
Applications Categorization

8. Applications selection criteria
Is the application already interfaced to any grid middleware?
How much experience do the developers and users have in grid computing?
How many people are proposing the application?
Are they EUChinaGRID Partners?
How many people can work on it?
Scientific and/or social impact of the application?
Applications selection criteria

9. Cross Projects Communities Identification
High Energy Physics
EGEE and EUChinaGRID
ATLAS and CMS
Structural Biology
EGEE, EUChinaGRID, SEEGRID, EELA
WISDOM
In silico structural genomics
Molecular dynamics
Docking
Protein-Protein Interactions
Cross Projects Communities Identification

10. There is a great room/need for collaboration between projects/communities
Redundancy but also complementarity of tools
Great synergy possibilities
CONCLUSIONS

11. Thank you for your attention !