Presentation is loading. Please wait.

Presentation is loading. Please wait.

Heterologous processing of editing sites after somatic or sexual transfer into a foreign genetic background. Heterologous processing of editing sites after.

Published byCaitlin Newman Modified over 6 years ago

Similar presentations

Presentation on theme: "Heterologous processing of editing sites after somatic or sexual transfer into a foreign genetic background. Heterologous processing of editing sites after."— Presentation transcript:

1 Heterologous processing of editing sites after somatic or sexual transfer into a foreign genetic background. Heterologous processing of editing sites after somatic or sexual transfer into a foreign genetic background. (A) Editing of ndhD‐293 in Nicotiana glutinosa, Nicotiana tabacum Petit Havanna and the introgression line N. tabacum Samsoun (NN). Excerpts of the sequencing chromatograms are shown, with the edited position marked by an asterisk and the affected codon boxed. Phenotypes of mature plants are shown, with the inset showing the different flower morphologies. Circles indicate the nuclei and ovals the plastids. Nt, N. tabacum Petit Havanna; Ng, N. glutinosa. Superscript N indicates the presence of the N‐gene conferring resistance against tobacco mosaic virus. (B) Complementary DNA sequence analysis of editing sites ndhA‐189 and ndhD‐293 in nightshade Ab(Ab) and cybrid Nt(Ab) seedlings. Relevant chromatogram excerpts are shown, with the edited position and codons marked as in (A). (C) Nicotiana tomentosiformis possesses and processes editing site ndhD‐293, whereas this site is absent in Nicotiana sylvestris and N. tabacum. Partial ndhD DNA sequences for the three Nicotiana species are aligned. Below is an excerpt of a cDNA sequence from N. tomentosiformis together with the corresponding chromatogram. Editing sites and affected codons are marked as in (A). Michael Tillich et al. EMBO Rep. 2006;7: © as stated in the article, figure or figure legend

Download ppt "Heterologous processing of editing sites after somatic or sexual transfer into a foreign genetic background. Heterologous processing of editing sites after."

Similar presentations

Fig. S1 A622 1 MVVSEKSKILIIGGTGYIGKYLVETSAKSGHPTFALIRESTLKNPEKSKLIDTFKSYGVT 60 A622L 1..................................V.......V................. 60 A622.

Fig. S1 A622 1 MVVSEKSKILIIGGTGYIGKYLVETSAKSGHPTFALIRESTLKNPEKSKLIDTFKSYGVT 60 A622L V V A622.
Alternative Splicing. mRNA Splicing During RNA processing internal segments are removed from the transcript and the remaining segments spliced together.

Alternative Splicing. mRNA Splicing During RNA processing internal segments are removed from the transcript and the remaining segments spliced together.
Figure S1. Genomic PCR of in vitro potato plants transformed with StPTB1 prom (top) and StPTB6 prom (bottom) constructs using nptII-specific primers. Thirty.

Figure S1. Genomic PCR of in vitro potato plants transformed with StPTB1 prom (top) and StPTB6 prom (bottom) constructs using nptII-specific primers. Thirty.
PCB6528 Spring 2014 - Exam 2 – Chase Name ____________________________ Page 1 of 4 1 [35 pt] In our discussion paper, Stegmann et al. (Proc. Natl. Acad.

PCB6528 Spring Exam 2 – Chase Name ____________________________ Page 1 of 4 1 [35 pt] In our discussion paper, Stegmann et al. (Proc. Natl. Acad.
Alternative Splicing. mRNA Splicing During RNA processing internal segments are removed from the transcript and the remaining segments spliced together.

Alternative Splicing. mRNA Splicing During RNA processing internal segments are removed from the transcript and the remaining segments spliced together.
Alternative Splicing. mRNA Splicing During RNA processing internal segments are removed from the transcript and the remaining segments spliced together.

Alternative Splicing. mRNA Splicing During RNA processing internal segments are removed from the transcript and the remaining segments spliced together.
From: Hepatitis B Virus Strains with Mutations in the Core Promoter in Patients with Fulminant Hepatitis Ann Intern Med. 1995;122(4):241-248. doi:10.7326/0003-4819-122-4-199502150-00001.

From: Hepatitis B Virus Strains with Mutations in the Core Promoter in Patients with Fulminant Hepatitis Ann Intern Med. 1995;122(4): doi: /
Figure 1. RISC activity in BYL. ( A ) Quantity of AGO1 protein in BYL

Figure 1. RISC activity in BYL. ( A ) Quantity of AGO1 protein in BYL
Accumulation of transcripts from MULE‐F19G14–CyP40 and transposons in mom1 and ddm1. Accumulation of transcripts from MULE‐F19G14–CyP40 and transposons.

Accumulation of transcripts from MULE‐F19G14–CyP40 and transposons in mom1 and ddm1. Accumulation of transcripts from MULE‐F19G14–CyP40 and transposons.
Structures of CK1 inhibitors and their effects on CK1 activity in vitro. Structures of CK1 inhibitors and their effects on CK1 activity in vitro. (A) Structures.

Structures of CK1 inhibitors and their effects on CK1 activity in vitro. Structures of CK1 inhibitors and their effects on CK1 activity in vitro. (A) Structures.
Statistical analysis of transgene expression in pigs generated by lentiviral gene transfer. Statistical analysis of transgene expression in pigs generated.

Statistical analysis of transgene expression in pigs generated by lentiviral gene transfer. Statistical analysis of transgene expression in pigs generated.
Yuming Lu, Jian-Kang Zhu  Molecular Plant 

Yuming Lu, Jian-Kang Zhu  Molecular Plant 
Reduced astrocyte proliferation results in increased immune cell infiltration into the injured GM Reduced astrocyte proliferation results in increased.

Reduced astrocyte proliferation results in increased immune cell infiltration into the injured GM Reduced astrocyte proliferation results in increased.
Transcribed strand breaks do not interfere with TFIIIB‐dependent recruitment of pol III to the promoter. Transcribed strand breaks do not interfere with.

Transcribed strand breaks do not interfere with TFIIIB‐dependent recruitment of pol III to the promoter. Transcribed strand breaks do not interfere with.
Nur77 interacts with COUP‐TF in yeast.

Nur77 interacts with COUP‐TF in yeast.
Mitochondrial uptake of different DNA substrates.

Mitochondrial uptake of different DNA substrates.
Leaky scanning past the CPA1 and arg‐2 uORFs.

Leaky scanning past the CPA1 and arg‐2 uORFs.
Protein sequences and three‐dimensional structures of HUB1 (homologous to ubiquitin 1), ubiquitin and ubiquitin‐like modifiers. Protein sequences and three‐dimensional.

Protein sequences and three‐dimensional structures of HUB1 (homologous to ubiquitin 1), ubiquitin and ubiquitin‐like modifiers. Protein sequences and three‐dimensional.
The cyclin B1 promoter is accessible to restriction endonucleases in vivo. The cyclin B1 promoter is accessible to restriction endonucleases in vivo. Nuclei.

The cyclin B1 promoter is accessible to restriction endonucleases in vivo. The cyclin B1 promoter is accessible to restriction endonucleases in vivo. Nuclei.
Knockdown of Gsc and Vent1/2 restores normal development of dorsal and ventral half‐embryos (n=52 or more per experimental set). Knockdown of Gsc and Vent1/2.

Knockdown of Gsc and Vent1/2 restores normal development of dorsal and ventral half‐embryos (n=52 or more per experimental set). Knockdown of Gsc and Vent1/2.

Similar presentations

Ads by Google