Presentation is loading. Please wait.

Presentation is loading. Please wait.

Figure S1. Sequence alignment of Arabidopsis NodGS with other plant and fungal orthologues. Abbreviations are as follows: Populus trichocarpa (Ptr), Ricinus.

Published byBlaise Willis Modified over 6 years ago

Similar presentations

Presentation on theme: "Figure S1. Sequence alignment of Arabidopsis NodGS with other plant and fungal orthologues. Abbreviations are as follows: Populus trichocarpa (Ptr), Ricinus."— Presentation transcript:

1 Figure S1. Sequence alignment of Arabidopsis NodGS with other plant and fungal orthologues.
Abbreviations are as follows: Populus trichocarpa (Ptr), Ricinus communis (Rco), Vitis vinifera (Vvi), Arabidopsis thaliana (Ath), Oryza sativa (Osa), Physcomitrella patens (Ppa), Aspergillus nidulans (Ani), and Ajellomyces capsulatus (Aca). ). The chemical nature of the individual amino acids is color-coded as follows: cyan, W,F,V,Y,L,I,H,M,A; orange, G; yellow, P; magenta, D,E; green, N,S,T,Q; red, R,K; pink, C. Identical amino acids are marked with asterisk, conserved substitutions are marked with colon, and semi-conserved substitutions are marked with dot.

Download ppt "Figure S1. Sequence alignment of Arabidopsis NodGS with other plant and fungal orthologues. Abbreviations are as follows: Populus trichocarpa (Ptr), Ricinus."

Similar presentations

Whats your favorite color? a pear a green pear.

Whats your favorite color? a pear a green pear.
The Build-up of the Red Sequence at z

The Build-up of the Red Sequence at z
Class I-A Class II-A Class II-B Class II- Basal Class I-B Class I Class II 0.1 Arabidopsis thaliana PHO1;H2 Capsella rubella PHO1;H11 100 Thellungiella.

Class I-A Class II-A Class II-B Class II- Basal Class I-B Class I Class II 0.1 Arabidopsis thaliana PHO1;H2 Capsella rubella PHO1;H Thellungiella.
Supplementary figure S3. Diagram showing the effects of removing data from particular organ types on the relative percentage of gene pairs showing reciprocal.

Supplementary figure S3. Diagram showing the effects of removing data from particular organ types on the relative percentage of gene pairs showing reciprocal.
COLORING WITH NUMBERS. NumbersNumbers NumbersNumbers 1-61-6 1-61-6.

COLORING WITH NUMBERS. NumbersNumbers NumbersNumbers
© red ©

© red ©
SNC2D. Primary LIGHT colours are red, green, and blue SECONDARY light colours are created by combining only two of the three primary colours of light.

SNC2D. Primary LIGHT colours are red, green, and blue SECONDARY light colours are created by combining only two of the three primary colours of light.
Figure S1. Effects of AVG, DIECA, DPI, NMMA, STA, and OKA on IbRPK expression in sweet potato (Ipomoea batatas cv. Tainung 57). Leaves with petiole cuts.

Figure S1. Effects of AVG, DIECA, DPI, NMMA, STA, and OKA on IbRPK expression in sweet potato (Ipomoea batatas cv. Tainung 57). Leaves with petiole cuts.
Figure S1 AtFTComFT2HGtFT1GtFT2 A. thaliana ( 29 dpi ) PsFTa1GtFT1InFT1 H PsFTa1 GtFT1 InFT1 H GtFT2 Tobacco ‘Xanthi nc’ (55 dpi) (86 dpi) (108 dpi) Figure.

Figure S1 AtFTComFT2HGtFT1GtFT2 A. thaliana ( 29 dpi ) PsFTa1GtFT1InFT1 H PsFTa1 GtFT1 InFT1 H GtFT2 Tobacco ‘Xanthi nc’ (55 dpi) (86 dpi) (108 dpi) Figure.
Cluster I. Cluster II Cluster III (contiued) Cluster IV.

Cluster I. Cluster II Cluster III (contiued) Cluster IV.
If you say 8 color the ones in your picture purple. If you say 9 color the ones in your picture blue.

If you say 8 color the ones in your picture purple. If you say 9 color the ones in your picture blue.
Spring Colors Enter our Garden to see all of the beautiful flowers that bloom in the Spring time.

Spring Colors Enter our Garden to see all of the beautiful flowers that bloom in the Spring time.
Fig. S1. Carotenoid and chlorophyll composition of Arabidopsis Z-ISO mutants compared to wild type. Seedlings were grown for 6d on half strength MS plus.

Fig. S1. Carotenoid and chlorophyll composition of Arabidopsis Z-ISO mutants compared to wild type. Seedlings were grown for 6d on half strength MS plus.
Supporting Fig. S1 OsRHR-GFP GFP ChlorophyllMerge GC Hoechst Merge GH Supporting Figure S1. The OsPHR-GFP fusion protein localizes to nuclei, chloroplasts,

Supporting Fig. S1 OsRHR-GFP GFP ChlorophyllMerge GC Hoechst Merge GH Supporting Figure S1. The OsPHR-GFP fusion protein localizes to nuclei, chloroplasts,
Seeing in colour Stare at the coloured dot in the middle of the next picture for a minute. Then describe what you see when you look at the next slide.

Seeing in colour Stare at the coloured dot in the middle of the next picture for a minute. Then describe what you see when you look at the next slide.
Crazy colors By teacher john. Basic colors! White Black red blue Light green yellow orange purple Grey Light blue green.

Crazy colors By teacher john. Basic colors! White Black red blue Light green yellow orange purple Grey Light blue green.
MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.
Volume 2, Issue 5, Pages (September 2009)

Volume 2, Issue 5, Pages (September 2009)
Volume 12, Issue 6, Pages (June 2005)

Volume 12, Issue 6, Pages (June 2005)
a. ZEP ZEP Os04g Selmo Phypa Chlre CTF2B

a. ZEP ZEP Os04g Selmo Phypa Chlre CTF2B

Similar presentations

Ads by Google