Presentation is loading. Please wait.

Presentation is loading. Please wait.

Fig. 1. NS1 protein alignment and linear epitope mapping of the 10 antibodies used to run the DENV serotype–specific NS1 rapid tests, pan-DENV NS1 test,

Published byLillian Hoover Modified over 6 years ago

Similar presentations

Presentation on theme: "Fig. 1. NS1 protein alignment and linear epitope mapping of the 10 antibodies used to run the DENV serotype–specific NS1 rapid tests, pan-DENV NS1 test,"— Presentation transcript:

1 Fig. 1. NS1 protein alignment and linear epitope mapping of the 10 antibodies used to run the DENV serotype–specific NS1 rapid tests, pan-DENV NS1 test, and ZIKV NS1 test. NS1 protein alignment and linear epitope mapping of the 10 antibodies used to run the DENV serotype–specific NS1 rapid tests, pan-DENV NS1 test, and ZIKV NS1 test. (A) Table listing mAb names, mAb immunochromatography applications, mAb linear epitope sequences and starting amino acid positions, and NS1 domain positions. (B) Comparison of amino acid similarity based on analysis of NS1 protein sequences from the following viruses: DENV1 (strain Singapore/S275/1990), accession number P33478; DENV2 (strain New Guinea C), accession number AAA42941; DENV3 (strain Philippines/H87/1956), accession number AAA99437; DENV4 (strain Singapore/8976/1995), accession number AAV31422; ZIKV, accession number KU Amino acid sequences were compared using Color Align Conservation to enhance the output of sequence alignment program. Residues that are identical among the sequences are boxed. Linear peptide epitopes (B) are italicized and indicated in color in the figure, with the key to the right of the figure. Irene Bosch et al., Sci Transl Med 2017;9:eaan1589 Published by AAAS

Download ppt "Fig. 1. NS1 protein alignment and linear epitope mapping of the 10 antibodies used to run the DENV serotype–specific NS1 rapid tests, pan-DENV NS1 test,"

Similar presentations

PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1.

PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1.
MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.
Fig. 1 CSF1 is increased in blood of melanoma patients and correlates with disease progression. CSF1 is increased in blood of melanoma patients and correlates.

Fig. 1 CSF1 is increased in blood of melanoma patients and correlates with disease progression. CSF1 is increased in blood of melanoma patients and correlates.
Fig. 7. Intrapatient variation in key contact signatures for PGDM1400 and PGT121. Intrapatient variation in key contact signatures for PGDM1400 and PGT121.

Fig. 7. Intrapatient variation in key contact signatures for PGDM1400 and PGT121. Intrapatient variation in key contact signatures for PGDM1400 and PGT121.
Prediction of IgE-binding epitopes by means of allergen surface comparison and correlation to cross-reactivity  Fabio Dall'Antonia, PhD, Anna Gieras,

Prediction of IgE-binding epitopes by means of allergen surface comparison and correlation to cross-reactivity  Fabio Dall'Antonia, PhD, Anna Gieras,
Sequence and comparison of the SDS protein.

Sequence and comparison of the SDS protein.
The 3.8 Å resolution cryo-EM structure of Zika virus

The 3.8 Å resolution cryo-EM structure of Zika virus
Fig. 5. Correlation between CD34+CD45RA−CD90+ cell dose, engraftment success, and onset of neutrophil/platelet recovery in nonhuman primates. Correlation.

Fig. 5. Correlation between CD34+CD45RA−CD90+ cell dose, engraftment success, and onset of neutrophil/platelet recovery in nonhuman primates. Correlation.
Supplemental Figure S1. Alignment of drimenol synthase amino acid sequences from P. hydropiper and V. officinalis. Amino acid sequences were aligned with.

Supplemental Figure S1. Alignment of drimenol synthase amino acid sequences from P. hydropiper and V. officinalis. Amino acid sequences were aligned with.
Multiple sequence alignment and analysis of SOFL proteins.

Multiple sequence alignment and analysis of SOFL proteins.
Rapid antigen tests for dengue virus serotypes and Zika virus in patient serum by Irene Bosch, Helena de Puig, Megan Hiley, Marc Carré-Camps, Federico.

Rapid antigen tests for dengue virus serotypes and Zika virus in patient serum by Irene Bosch, Helena de Puig, Megan Hiley, Marc Carré-Camps, Federico.
Fig. 5. Circulating PPi concentration does not correlate with severity of calcification phenotype in mice. Circulating PPi concentration does not correlate.

Fig. 5. Circulating PPi concentration does not correlate with severity of calcification phenotype in mice. Circulating PPi concentration does not correlate.
Fig. 4. Intramuscular injection of AAV9-Cas9/sgRNA-51 corrects dystrophin expression. Intramuscular injection of AAV9-Cas9/sgRNA-51 corrects dystrophin.

Fig. 4. Intramuscular injection of AAV9-Cas9/sgRNA-51 corrects dystrophin expression. Intramuscular injection of AAV9-Cas9/sgRNA-51 corrects dystrophin.
Fig. 3. Structure of ALS-associated RNA binding proteins.

Fig. 3. Structure of ALS-associated RNA binding proteins.
Fig. 8. Gene and protein changes in ALK-dependent STING pathways in human sepsis. Gene and protein changes in ALK-dependent STING pathways in human sepsis.

Fig. 8. Gene and protein changes in ALK-dependent STING pathways in human sepsis. Gene and protein changes in ALK-dependent STING pathways in human sepsis.
Fig. 3. Antimicrobial activity is detected in diverse strains of CoNS and not predictable at the species level. Antimicrobial activity is detected in diverse.

Fig. 3. Antimicrobial activity is detected in diverse strains of CoNS and not predictable at the species level. Antimicrobial activity is detected in diverse.
Fig. 5. Correlation of tail and long bone growth velocities with Cxm serum concentrations in mice. Correlation of tail and long bone growth velocities.

Fig. 5. Correlation of tail and long bone growth velocities with Cxm serum concentrations in mice. Correlation of tail and long bone growth velocities.
Strategy for CRISPR/Cas9-mediated genome editing in ΔEx50 mice

Strategy for CRISPR/Cas9-mediated genome editing in ΔEx50 mice
Fig. 4. Liver HBV mRNA paired-end sequencing reads in HBeAg-positive and HBeAg-negative chimpanzees. Liver HBV mRNA paired-end sequencing reads in HBeAg-positive.

Fig. 4. Liver HBV mRNA paired-end sequencing reads in HBeAg-positive and HBeAg-negative chimpanzees. Liver HBV mRNA paired-end sequencing reads in HBeAg-positive.
Fig. 2. Associations between bacterial taxa abundance ascertained by fecal shotgun metagenomic sequencing and the fecal metabolome in healthy pediatric.

Fig. 2. Associations between bacterial taxa abundance ascertained by fecal shotgun metagenomic sequencing and the fecal metabolome in healthy pediatric.

Similar presentations

Ads by Google