Download presentation
Presentation is loading. Please wait.
Published byRenate Becke Modified over 6 years ago
1
CSE 5290: Algorithms for Bioinformatics Fall 2009
Suprakash Datta Office: CSEB 3043 Phone: ext 77875 Course page: 11/30/2018 CSE 5290, Fall 2009
2
Next Pattern matching Some of the following slides are based on slides by the authors of our text. 11/30/2018 CSE 5290, Fall 2009
3
Genomic Repeats Example of repeats: ATGGTCTAGGTCCTAGTGGTC
Motivation to find them: Genomic rearrangements are often associated with repeats Trace evolutionary secrets Many tumors are characterized by an explosion of repeats 11/30/2018 CSE 5290, Fall 2009
4
Genomic Repeats The problem is often more difficult:
ATGGTCTAGGACCTAGTGTTC Motivation to find them: Genomic rearrangements are often associated with repeats Trace evolutionary secrets Many tumors are characterized by an explosion of repeats 11/30/2018 CSE 5290, Fall 2009
5
l-mer Repeats Long repeats are difficult to find
Short repeats are easy to find (e.g., hashing) Simple approach to finding long repeats: Find exact repeats of short l-mers (l is usually 10 to 13) Use l-mer repeats to potentially extend into longer, maximal repeats 11/30/2018 CSE 5290, Fall 2009
6
l-mer Repeats (cont’d)
There are typically many locations where an l-mer is repeated: GCTTACAGATTCAGTCTTACAGATGGT The 4-mer TTAC starts at locations 3 and 17 11/30/2018 CSE 5290, Fall 2009
7
Extending l-mer Repeats
GCTTACAGATTCAGTCTTACAGATGGT Extend these 4-mer matches: Maximal repeat: TTACAGAT 11/30/2018 CSE 5290, Fall 2009
8
Maximal Repeats To find maximal repeats in this way, we need ALL start locations of all l-mers in the genome Hashing lets us find repeats quickly in this manner 11/30/2018 CSE 5290, Fall 2009
9
Hashing: What is it? What does hashing do?
For different data, generate a unique integer Store data in an array at the unique integer index generated from the data Hashing is a very efficient way to store and retrieve data 11/30/2018 CSE 5290, Fall 2009
10
Hashing: Definitions Hash table: array used in hashing
Records: data stored in a hash table Keys: identifies sets of records Buckets: Hash function: uses a key to generate an index (bucket) to insert at in hash table Collision: when more than one record is mapped to the same index in the hash table 11/30/2018 CSE 5290, Fall 2009
11
When does hashing work well?
When there are few collisions! Good hash functions minimize collisions Problems knowing what function to use What buckets to use 11/30/2018 CSE 5290, Fall 2009
12
Hashing: Example Where do the animals eat? Records: each animal
Keys: where each animal eats 11/30/2018 CSE 5290, Fall 2009
13
Hashing DNA sequences Each l-mer can be translated into a binary string (A, T, C, G can be represented as 00, 01, 10, 11) After assigning a unique integer per l-mer it is easy to get all start locations of each l-mer in a genome 11/30/2018 CSE 5290, Fall 2009
14
Hashing: Maximal Repeats
To find repeats in a genome: For all l-mers in the genome, note the start position and the sequence Generate a hash table index for each unique l-mer sequence In each index of the hash table, store all genome start locations of the l-mer which generated that index Extend l-mer repeats to maximal repeats 11/30/2018 CSE 5290, Fall 2009
15
Hashing: Collisions Dealing with collisions:
“Chain” all start locations of l-mers (linked list) 11/30/2018 CSE 5290, Fall 2009
16
Hashing: Summary When finding genomic repeats from l-mers:
Generate a hash table index for each l-mer sequence In each index, store all genome start locations of the l-mer which generated that index Extend l-mer repeats to maximal repeats 11/30/2018 CSE 5290, Fall 2009
17
Pattern Matching What if, instead of finding repeats in a genome, we want to find all sequences in a database that contain a given pattern? This leads us to a different problem, the Pattern Matching Problem 11/30/2018 CSE 5290, Fall 2009
18
Pattern Matching Problem
Goal: Find all occurrences of a pattern in a text Input: Pattern p = p1…pn and text t = t1…tm Output: All positions 1< i < (m – n + 1) such that the n-letter substring of t starting at i matches p Motivation: Searching database for a known pattern 11/30/2018 CSE 5290, Fall 2009
19
Exact Pattern Matching: A Brute-Force Algorithm
PatternMatching(p,t) n length of pattern p m length of text t for i 1 to (m – n + 1) if ti…ti+n-1 = p output i 11/30/2018 CSE 5290, Fall 2009
20
Exact Pattern Matching: An Example
PatternMatching algorithm for: Pattern GCAT Text CGCATC GCAT CGCATC GCAT CGCATC GCAT CGCATC GCAT CGCATC GCAT CGCATC 11/30/2018 CSE 5290, Fall 2009
21
Exact Pattern Matching: Running Time
PatternMatching runtime: O(nm) Probability-wise, it’s more like O(m) Rarely will there be close to n comparisons in line 4 Better solution: suffix trees Can solve problem in O(m) time Conceptually related to keyword trees 11/30/2018 CSE 5290, Fall 2009
22
Keyword Trees: Example
Apple 11/30/2018 CSE 5290, Fall 2009
23
Keyword Trees: Example (cont’d)
Apple Apropos 11/30/2018 CSE 5290, Fall 2009
24
Keyword Trees: Example (cont’d)
Apple Apropos Banana 11/30/2018 CSE 5290, Fall 2009
25
Keyword Trees: Example (cont’d)
Apple Apropos Banana Bandana 11/30/2018 CSE 5290, Fall 2009
26
Keyword Trees: Example (cont’d)
Apple Apropos Banana Bandana Orange 11/30/2018 CSE 5290, Fall 2009
27
Keyword Trees: Properties
-Stores a set of keywords in a rooted labeled tree Each edge labeled with a letter from an alphabet Any two edges coming out of the same vertex have distinct labels Every keyword stored can be spelled on a path from root to some leaf 11/30/2018 CSE 5290, Fall 2009
28
Keyword Trees: Threading (cont’d)
Thread “appeal” appeal 11/30/2018 CSE 5290, Fall 2009
29
Keyword Trees: Threading (cont’d)
Thread “appeal” appeal 11/30/2018 CSE 5290, Fall 2009
30
Keyword Trees: Threading (cont’d)
Thread “appeal” appeal 11/30/2018 CSE 5290, Fall 2009
31
Keyword Trees: Threading (cont’d)
Thread “appeal” appeal 11/30/2018 CSE 5290, Fall 2009
32
Keyword Trees: Threading (cont’d)
Thread “apple” apple 11/30/2018 CSE 5290, Fall 2009
33
Keyword Trees: Threading (cont’d)
Thread “apple” apple 11/30/2018 CSE 5290, Fall 2009
34
Keyword Trees: Threading (cont’d)
Thread “apple” apple 11/30/2018 CSE 5290, Fall 2009
35
Keyword Trees: Threading (cont’d)
Thread “apple” apple 11/30/2018 CSE 5290, Fall 2009
36
Keyword Trees: Threading (cont’d)
Thread “apple” apple 11/30/2018 CSE 5290, Fall 2009
37
Multiple Pattern Matching Problem
Goal: Given a set of patterns and a text, find all occurrences of any of patterns in text Input: k patterns p1,…,pk, and text t = t1…tm Output: Positions 1 < i < m where substring of t starting at i matches pj for 1 < j < k Motivation: Searching database for known multiple patterns 11/30/2018 CSE 5290, Fall 2009
38
Multiple Pattern Matching: Straightforward Approach
Can solve as k “Pattern Matching Problems” Runtime: O(kmn) using the PatternMatching algorithm k times m - length of the text n - average length of the pattern 11/30/2018 CSE 5290, Fall 2009
39
Multiple Pattern Matching: Keyword Tree Approach
Or, we could use keyword trees: Build keyword tree in O(N) time; N is total length of all patterns With naive threading: O(N + nm) Aho-Corasick algorithm: O(N + m) 11/30/2018 CSE 5290, Fall 2009
40
Keyword Trees: Threading
To match patterns in a text using a keyword tree: Build keyword tree of patterns “Thread” the text through the keyword tree 11/30/2018 CSE 5290, Fall 2009
41
Keyword Trees: Threading (cont’d)
Threading is “complete” when we reach a leaf in the keyword tree When threading is “complete,” we’ve found a pattern in the text 11/30/2018 CSE 5290, Fall 2009
42
Suffix Trees=Collapsed Keyword Trees
Similar to keyword trees, except edges that form paths are collapsed Each edge is labeled with a substring of a text All internal edges have at least two outgoing edges Leaves labeled by the index of the pattern. 11/30/2018 CSE 5290, Fall 2009
43
Suffix Tree of a Text ATCATG TCATG CATG ATG TG G Keyword Tree
Suffix trees of a text is constructed for all its suffixes ATCATG TCATG CATG ATG TG G Keyword Tree Suffix Tree 11/30/2018 CSE 5290, Fall 2009
44
Suffix Tree of a Text ATCATG TCATG CATG ATG TG G Keyword Tree
Suffix trees of a text is constructed for all its suffixes ATCATG TCATG CATG ATG TG G Keyword Tree Suffix Tree How much time does it take? 11/30/2018 CSE 5290, Fall 2009
45
Suffix Tree of a Text ATCATG TCATG CATG ATG TG G Keyword Tree
Suffix trees of a text is constructed for all its suffixes ATCATG TCATG CATG ATG TG G Keyword Tree Suffix Tree quadratic Time is linear in the total size of all suffixes, i.e., it is quadratic in the length of the text 11/30/2018 CSE 5290, Fall 2009
46
Suffix Trees: Advantages
Suffix trees of a text is constructed for all its suffixes Suffix trees build faster than keyword trees ATCATG TCATG CATG ATG TG G Keyword Tree Suffix Tree quadratic linear (Weiner suffix tree algorithm) 11/30/2018 CSE 5290, Fall 2009
47
Use of Suffix Trees Suffix trees hold all suffixes of a text
i.e., ATCGC: ATCGC, TCGC, CGC, GC, C Builds in O(m) time for text of length m To find any pattern of length n in a text: Build suffix tree for text Thread the pattern through the suffix tree Can find pattern in text in O(n) time! O(n + m) time for “Pattern Matching Problem” Build suffix tree and lookup pattern 11/30/2018 CSE 5290, Fall 2009
48
Pattern Matching with Suffix Trees
SuffixTreePatternMatching(p,t) Build suffix tree for text t Thread pattern p through suffix tree if threading is complete output positions of all p-matching leaves in the tree else output “Pattern does not appear in text” 11/30/2018 CSE 5290, Fall 2009
49
Suffix Trees: Example 11/30/2018 CSE 5290, Fall 2009
50
Multiple Pattern Matching: Summary
Keyword and suffix trees are used to find patterns in a text Keyword trees: Build keyword tree of patterns, and thread text through it Suffix trees: Build suffix tree of text, and thread patterns through it 11/30/2018 CSE 5290, Fall 2009
51
Approximate vs. Exact Pattern Matching
So far all we’ve seen exact pattern matching algorithms Usually, because of mutations, it makes much more biological sense to find approximate pattern matches Biologists often use fast heuristic approaches (rather than local alignment) to find approximate matches 11/30/2018 CSE 5290, Fall 2009
52
Heuristic Similarity Searches
Genomes are huge: Smith-Waterman quadratic alignment algorithms are too slow Alignment of two sequences usually has short identical or highly similar fragments Many heuristic methods (i.e., FASTA) are based on the same idea of filtration Find short exact matches, and use them as seeds for potential match extension “Filter” out positions with no extendable matches 11/30/2018 CSE 5290, Fall 2009
53
Dot Matrices Dot matrices show similarities between two sequences
FASTA makes an implicit dot matrix from short exact matches, and tries to find long diagonals (allowing for some mismatches) 11/30/2018 CSE 5290, Fall 2009
54
Dot Matrices (cont’d) Identify diagonals above a threshold length
Diagonals in the dot matrix indicate exact substring matching 11/30/2018 CSE 5290, Fall 2009
55
Diagonals in Dot Matrices
Extend diagonals and try to link them together, allowing for minimal mismatches/indels Linking diagonals reveals approximate matches over longer substrings 11/30/2018 CSE 5290, Fall 2009
56
Approximate Pattern Matching Problem
Goal: Find all approximate occurrences of a pattern in a text Input: A pattern p = p1…pn, text t = t1…tm, and k, the maximum number of mismatches Output: All positions 1 < i < (m – n + 1) such that ti…ti+n-1 and p1…pn have at most k mismatches (i.e., Hamming distance between ti…ti+n-1 and p < k) 11/30/2018 CSE 5290, Fall 2009
57
Approximate Pattern Matching: A Brute-Force Algorithm
ApproximatePatternMatching(p, t, k) n length of pattern p m length of text t for i 1 to m – n + 1 dist 0 for j 1 to n if ti+j-1 != pj dist dist + 1 if dist < k output i 11/30/2018 CSE 5290, Fall 2009
58
Approximate Pattern Matching: Running Time
That algorithm runs in O(nm). Landau-Vishkin algorithm: O(kn) We can generalize the “Approximate Pattern Matching Problem” into a “Query Matching Problem”: We want to match substrings in a query to substrings in a text with at most k mismatches Motivation: we want to see similarities to some gene, but we may not know which parts of the gene to look for 11/30/2018 CSE 5290, Fall 2009
59
Query Matching Problem
Goal: Find all substrings of the query that approximately match the text Input: Query q = q1…qw, text t = t1…tm, n (length of matching substrings), k (maximum number of mismatches) Output: All pairs of positions (i, j) such that the n-letter substring of q starting at i approximately matches the n-letter substring of t starting at j, with at most k mismatches 11/30/2018 CSE 5290, Fall 2009
60
Approximate Pattern Matching vs Query Matching
11/30/2018 CSE 5290, Fall 2009
61
Query Matching: Main Idea
Approximately matching strings share some perfectly matching substrings. Instead of searching for approximately matching strings (difficult) search for perfectly matching substrings (easy). 11/30/2018 CSE 5290, Fall 2009
62
Filtration in Query Matching
We want all n-matches between a query and a text with up to k mismatches “Filter” out positions we know do not match between text and query Potential match detection: find all matches of l-tuples in query and text for some small l Potential match verification: Verify each potential match by extending it to the left and right, until (k + 1) mismatches are found 11/30/2018 CSE 5290, Fall 2009
63
Filtration: Match Detection
If x1…xn and y1…yn match with at most k mismatches, they must share an l-tuple that is perfectly matched, with l = n/(k + 1) Break string of length n into k+1 parts, each each of length n/(k + 1) k mismatches can affect at most k of these k+1 parts At least one of these k+1 parts is perfectly matched 11/30/2018 CSE 5290, Fall 2009
64
Filtration: Match Detection (cont’d)
Suppose k = 3. We would then have l=n/(k+1)=n/4: There are at most k mismatches in n, so at the very least there must be one out of the k+1 l –tuples without a mismatch 1…l l +1…2l 2l +1…3l 3l +1…n 1 2 k k + 1 11/30/2018 CSE 5290, Fall 2009
65
Filtration: Match Verification
For each l -match we find, try to extend the match further to see if it is substantial Extend perfect match of length l until we find an approximate match of length n with k mismatches query text 11/30/2018 CSE 5290, Fall 2009
66
Filtration: Example Shorter perfect matches required
k = 0 k = 1 k = 2 k = 3 k = 4 k = 5 l -tuple length n n/2 n/3 n/4 n/5 n/6 Shorter perfect matches required Performance decreases 11/30/2018 CSE 5290, Fall 2009
67
Local alignment is to slow…
Quadratic local alignment is too slow while looking for similarities between long strings (e.g. the entire GenBank database) 11/30/2018 CSE 5290, Fall 2009
68
Local alignment is to slow…
Quadratic local alignment is too slow while looking for similarities between long strings (e.g. the entire GenBank database) 11/30/2018 CSE 5290, Fall 2009
69
Local alignment is to slow…
Quadratic local alignment is too slow while looking for similarities between long strings (e.g. the entire GenBank database) 11/30/2018 CSE 5290, Fall 2009
70
Local alignment is to slow…
Quadratic local alignment is too slow while looking for similarities between long strings (e.g. the entire GenBank database) Guaranteed to find the optimal local alignment Sets the standard for sensitivity 11/30/2018 CSE 5290, Fall 2009
71
Local alignment is to slow…
Quadratic local alignment is too slow while looking for similarities between long strings (e.g. the entire GenBank database) Basic Local Alignment Search Tool Altschul, S., Gish, W., Miller, W., Myers, E. & Lipman, D.J. Journal of Mol. Biol., 1990 Search sequence databases for local alignments to a query 11/30/2018 CSE 5290, Fall 2009
72
BLAST Great improvement in speed, with a modest decrease in sensitivity Minimizes search space instead of exploring entire search space between two sequences Finds short exact matches (“seeds”), only explores locally around these “hits” 1. 11/30/2018 CSE 5290, Fall 2009
73
What Similarity Reveals
BLASTing a new gene Evolutionary relationship Similarity between protein function BLASTing a genome Potential genes 11/30/2018 CSE 5290, Fall 2009
74
BLAST algorithm Keyword search of all words of length w from the query of length n in database of length m with score above threshold w = 11 for DNA queries, w =3 for proteins Local alignment extension for each found keyword Extend result until longest match above threshold is achieved Running time O(nm) 11/30/2018 CSE 5290, Fall 2009
75
BLAST algorithm (cont’d)
keyword Query: KRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD GVK 18 GAK 16 GIK 16 GGK 14 GLK 13 GNK 12 GRK 11 GEK 11 GDK 11 Neighborhood words neighborhood score threshold (T = 13) extension Query: 22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK 60 +++DN +G + IR L G+K I+ L+ E+ RG++K Sbjct: 226 IIKDNGRGFSGKQIRNLNYGIGLKVIADLV-EKHRGIIK 263 High-scoring Pair (HSP) 11/30/2018 CSE 5290, Fall 2009
Similar presentations
© 2025 SlidePlayer.com. Inc.
All rights reserved.