Presentation is loading. Please wait.

Presentation is loading. Please wait.

Secondary‐structure‐weighted sequence alignment of TssF1 with the N‐terminal region of gp6 and TssG1 with gp53 Secondary‐structure‐weighted sequence alignment.

Published byElemér Kelemen Modified over 5 years ago

Similar presentations

Presentation on theme: "Secondary‐structure‐weighted sequence alignment of TssF1 with the N‐terminal region of gp6 and TssG1 with gp53 Secondary‐structure‐weighted sequence alignment."— Presentation transcript:

1 Secondary‐structure‐weighted sequence alignment of TssF1 with the N‐terminal region of gp6 and TssG1 with gp53 Secondary‐structure‐weighted sequence alignment of TssF1 with the N‐terminal region of gp6 and TssG1 with gp53 A, BProtein sequences were extracted from UniProt accession numbers BP06_BPT4 and BP53_BPT4 for enterobacteria phage T4 (gp6 and gp53, respectively; bacteriophage T4) and the Pseudomonas Genome Database (TssF1 and TssG1; reference strain PAO1). Conserved positions from (A) the TssF1/gp6 and (B) the TssG1/gp53 sequence alignments are shown in black and grey background. Secondary‐structure‐weighted sequence alignments were carried out using PROMALS3D. Sara Planamente et al. EMBO J. 2016;embj © as stated in the article, figure or figure legend

Download ppt "Secondary‐structure‐weighted sequence alignment of TssF1 with the N‐terminal region of gp6 and TssG1 with gp53 Secondary‐structure‐weighted sequence alignment."

Similar presentations

Yersinia Palindromic Sequences Introduction to Bioinformatics 301 April 30th, 2015 Jordan Davis.

Yersinia Palindromic Sequences Introduction to Bioinformatics 301 April 30th, 2015 Jordan Davis.
MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.
From: Pseudomonas Keratitis: Protease IV Gene Conservation, Distribution, and Production Relative to Virulence and Other Pseudomonas Proteases Invest.

From: Pseudomonas Keratitis: Protease IV Gene Conservation, Distribution, and Production Relative to Virulence and Other Pseudomonas Proteases Invest.
Accumulation of transcripts from MULE‐F19G14–CyP40 and transposons in mom1 and ddm1. Accumulation of transcripts from MULE‐F19G14–CyP40 and transposons.

Accumulation of transcripts from MULE‐F19G14–CyP40 and transposons in mom1 and ddm1. Accumulation of transcripts from MULE‐F19G14–CyP40 and transposons.
The determinants of the interswitch toggle.

The determinants of the interswitch toggle.
Prostaglandin E2 (PGE2) induces no significant alteration in circadian locomotor activity. Prostaglandin E2 (PGE2) induces no significant alteration in.

Prostaglandin E2 (PGE2) induces no significant alteration in circadian locomotor activity. Prostaglandin E2 (PGE2) induces no significant alteration in.
Statistical analysis of transgene expression in pigs generated by lentiviral gene transfer. Statistical analysis of transgene expression in pigs generated.

Statistical analysis of transgene expression in pigs generated by lentiviral gene transfer. Statistical analysis of transgene expression in pigs generated.
Sequence and expression of Xenopus EAF2.

Sequence and expression of Xenopus EAF2.
The effect of amino acid substitution in the kinase inhibitory region of JAB. (A) Unchanged amino acids are shown as dots, substituted amino acids by a.

The effect of amino acid substitution in the kinase inhibitory region of JAB. (A) Unchanged amino acids are shown as dots, substituted amino acids by a.
Model for the involvement of Rep helicases as genome packaging motors.

Model for the involvement of Rep helicases as genome packaging motors.
Different ubiquitin linkage types and their role in immune signallingUbiquitin, a small protein of 76 amino acids, can be attached to a substrate protein.

Different ubiquitin linkage types and their role in immune signallingUbiquitin, a small protein of 76 amino acids, can be attached to a substrate protein.
Surface distribution of immunogold‐labelled PS I (A–C) and ATP synthase (D–F) complexes. Surface distribution of immunogold‐labelled PS I (A–C) and ATP.

Surface distribution of immunogold‐labelled PS I (A–C) and ATP synthase (D–F) complexes. Surface distribution of immunogold‐labelled PS I (A–C) and ATP.
Nur77 interacts with COUP‐TF in yeast.

Nur77 interacts with COUP‐TF in yeast.
(A, B) Stereoscopic views of the P3 RNase MRP RNA domain in complex with the RNase MRP/RNase P protein components Pop6 and Pop7. (A, B) Stereoscopic views.

(A, B) Stereoscopic views of the P3 RNase MRP RNA domain in complex with the RNase MRP/RNase P protein components Pop6 and Pop7. (A, B) Stereoscopic views.
Protein sequences and three‐dimensional structures of HUB1 (homologous to ubiquitin 1), ubiquitin and ubiquitin‐like modifiers. Protein sequences and three‐dimensional.

Protein sequences and three‐dimensional structures of HUB1 (homologous to ubiquitin 1), ubiquitin and ubiquitin‐like modifiers. Protein sequences and three‐dimensional.
Yeast containing pICC10 (Tir) and pICC267 (CK18) and pTY474S and pICC267 demonstrated an approximately 12.5‐fold increase in β‐galactosidase activity compared.

Yeast containing pICC10 (Tir) and pICC267 (CK18) and pTY474S and pICC267 demonstrated an approximately 12.5‐fold increase in β‐galactosidase activity compared.
Growth advantage of strains carrying the different xer core sequences in place of dif over a Δ(dif) strain. Growth advantage of strains carrying the different.

Growth advantage of strains carrying the different xer core sequences in place of dif over a Δ(dif) strain. Growth advantage of strains carrying the different.
1,25‐dihydroxyvitamin D3 and retinoic acid induce p19ink4d expression.

1,25‐dihydroxyvitamin D3 and retinoic acid induce p19ink4d expression.
Xer recombination at variant sites.

Xer recombination at variant sites.
FtsK‐independent dif recombination in the presence of HinXerC.

FtsK‐independent dif recombination in the presence of HinXerC.

Similar presentations

Ads by Google