Presentation is loading. Please wait.

Presentation is loading. Please wait.

Characterization and Mutation Analysis of Human LEFTY A and LEFTY B, Homologues of Murine Genes Implicated in Left-Right Axis Development  K. Kosaki,

Published byせいごろう いのら Modified over 5 years ago

Similar presentations

Presentation on theme: "Characterization and Mutation Analysis of Human LEFTY A and LEFTY B, Homologues of Murine Genes Implicated in Left-Right Axis Development  K. Kosaki,"— Presentation transcript:

1 Characterization and Mutation Analysis of Human LEFTY A and LEFTY B, Homologues of Murine Genes Implicated in Left-Right Axis Development  K. Kosaki, R. Kosaki, M.T. Bassi, M. Lewin, J. Belmont, G. Schauer, B. Casey  The American Journal of Human Genetics  Volume 64, Issue 3, Pages (March 1999) DOI: /302289 Copyright © 1999 The American Society of Human Genetics Terms and Conditions

2 Figure 1 Genomic organization of human LEFTY A and LEFTY B. Top, long-range restriction map of PAC clone RPCI-73A4, which contains both genes. Center, intron-exon organization. Coding regions of exons are indicated by darkened boxes and untranslated regions by open boxes. Numbered arrows correspond to primers used in SSCP analysis (see table 1). Hatched lines show location of amino acids encoded by each exon within the final protein products. Bottom, Corresponding cDNA clones . The American Journal of Human Genetics  , DOI: ( /302289) Copyright © 1999 The American Society of Human Genetics Terms and Conditions

3 Figure 2 cDNA sequence and deduced amino acid sequence of LEFTY B.
The American Journal of Human Genetics  , DOI: ( /302289) Copyright © 1999 The American Society of Human Genetics Terms and Conditions

4 Figure 3 a, Protein sequence alignment of the Lefty homologues. Numbers on the right refer to amino acid position. Putative signal peptide and RXXR (proteolytic cleavage) sites are underlined. The six cysteine residues conserved among TGF-β family members are highlighted. The R314X and S342K mutations identified in LEFTY A are located in the region that forms the cysteine knot (see text). b, Pairwise comparison of amino acid identity among Lefty-related proteins. The American Journal of Human Genetics  , DOI: ( /302289) Copyright © 1999 The American Society of Human Genetics Terms and Conditions

5 Figure 4 RARE of Lefty1 (Oulad-Abdelghani et al. 1998), LEFTY A, and LEFTY B, identified in the 5′ flanking region of exon 1. Two hexamers (palindrome position in boldface) flank a conserved 8-bp spacer (boxed). The American Journal of Human Genetics  , DOI: ( /302289) Copyright © 1999 The American Society of Human Genetics Terms and Conditions

Download ppt "Characterization and Mutation Analysis of Human LEFTY A and LEFTY B, Homologues of Murine Genes Implicated in Left-Right Axis Development  K. Kosaki,"

Similar presentations

Functional Analysis of the Neurofibromatosis Type 2 Protein by Means of Disease- Causing Point Mutations Renee P. Stokowski, David R. Cox The American.

Functional Analysis of the Neurofibromatosis Type 2 Protein by Means of Disease- Causing Point Mutations Renee P. Stokowski, David R. Cox The American.
MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.
Avery A. Sandberg, Julia A. Bridge  Cancer Genetics and Cytogenetics 

Avery A. Sandberg, Julia A. Bridge  Cancer Genetics and Cytogenetics 
Figure 1. Structure of the fly LGR2 gene and the corresponding cDNA sequence. A, Derivation of the fly LGR2 full-length cDNA from the genomic sequence.

Figure 1. Structure of the fly LGR2 gene and the corresponding cDNA sequence. A, Derivation of the fly LGR2 full-length cDNA from the genomic sequence.
Volume 88, Issue 5, Pages (March 1997)

Volume 88, Issue 5, Pages (March 1997)
Detection of Exon 12 Mutations in the JAK2 Gene

Detection of Exon 12 Mutations in the JAK2 Gene
Structure of the Gene for Congenital Nephrotic Syndrome of the Finnish Type (NPHS1) and Characterization of Mutations  Ulla Lenkkeri, Minna Männikkö,

Structure of the Gene for Congenital Nephrotic Syndrome of the Finnish Type (NPHS1) and Characterization of Mutations  Ulla Lenkkeri, Minna Männikkö,
Protein-Truncation Mutations in the RP2 Gene in a North American Cohort of Families with X-Linked Retinitis Pigmentosa  Alan J. Mears, Linn Gieser, Denise.

Protein-Truncation Mutations in the RP2 Gene in a North American Cohort of Families with X-Linked Retinitis Pigmentosa  Alan J. Mears, Linn Gieser, Denise.
Mark M Metzstein, H.Robert Horvitz  Molecular Cell 

Mark M Metzstein, H.Robert Horvitz  Molecular Cell 
by Wen-feng Xu, Zhi-wei Xie, Dominic W. Chung, and Earl W. Davie

by Wen-feng Xu, Zhi-wei Xie, Dominic W. Chung, and Earl W. Davie
(A) Block diagram of the precursor proteins predicted from the Oak1, 2, 3, and 4 clones showing the signal peptide (light shading), the regions corresponding.

(A) Block diagram of the precursor proteins predicted from the Oak1, 2, 3, and 4 clones showing the signal peptide (light shading), the regions corresponding.
A Member of a Gene Family on Xp22

A Member of a Gene Family on Xp22
Mutations in the Liver Glycogen Phosphorylase Gene (PYGL) Underlying Glycogenosis Type VI (Hers Disease)  Barbara Burwinkel, Henk D. Bakker, Eliezer Herschkovitz,

Mutations in the Liver Glycogen Phosphorylase Gene (PYGL) Underlying Glycogenosis Type VI (Hers Disease)  Barbara Burwinkel, Henk D. Bakker, Eliezer Herschkovitz,
Mutation of a Nuclear Respiratory Factor 2 Binding Site in the 5′ Untranslated Region of the ADSL Gene in Three Patients with Adenylosuccinate Lyase Deficiency 

Mutation of a Nuclear Respiratory Factor 2 Binding Site in the 5′ Untranslated Region of the ADSL Gene in Three Patients with Adenylosuccinate Lyase Deficiency 
The Molecular Basis of Malonyl-CoA Decarboxylase Deficiency

The Molecular Basis of Malonyl-CoA Decarboxylase Deficiency
Jacquelyn Bond, Sheila Scott, Daniel J

Jacquelyn Bond, Sheila Scott, Daniel J
Both of the N-Terminal and C-Terminal Regions of Human Papillomavirus Type 16 E7 are Essential for Immortalization of Primary Rat Cells  Toshiharu Yamashita,

Both of the N-Terminal and C-Terminal Regions of Human Papillomavirus Type 16 E7 are Essential for Immortalization of Primary Rat Cells  Toshiharu Yamashita,
Detection of Exon 12 Mutations in the JAK2 Gene

Detection of Exon 12 Mutations in the JAK2 Gene
Volume 20, Issue 12, Pages (June 2010)

Volume 20, Issue 12, Pages (June 2010)
Progress in Molecular Genetics of Heritable Skin Diseases: The Paradigms of Epidermolysis Bullosa and Pseudoxanthoma Elasticum  Jouni Uitto, Leena Pulkkinen,

Progress in Molecular Genetics of Heritable Skin Diseases: The Paradigms of Epidermolysis Bullosa and Pseudoxanthoma Elasticum  Jouni Uitto, Leena Pulkkinen,

Similar presentations

Ads by Google