Presentation is loading. Please wait.

Presentation is loading. Please wait.

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

Published byFanny Muljana Modified over 5 years ago

Similar presentations

Presentation on theme: "Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin."— Presentation transcript:

1 Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins.
Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. The Ca2+-binding domain is indicated in bold type. Conserved residues are marked by an asterisk; conservative differences are marked by a full point. Sources, references and accession numbers are described in Materials and methods. Katerina A. Moutou et al. J Exp Biol 2001;204: © The Company of Biologists Limited 2001

Download ppt "Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin."

Similar presentations

Comparison of p53 Structure: Wild type vs. mutant What change in wild type p53 may lead to cancer?

Comparison of p53 Structure: Wild type vs. mutant What change in wild type p53 may lead to cancer?
MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.
MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.
Fig. 1. (A) The nucleotide and deduced amino acid sequences of the vacuolar serine protease protein of F. proliferatum (Fus p 9.0101, GenBank accession.

Fig. 1. (A) The nucleotide and deduced amino acid sequences of the vacuolar serine protease protein of F. proliferatum (Fus p , GenBank accession.
Fig. 1. NS1 protein alignment and linear epitope mapping of the 10 antibodies used to run the DENV serotype–specific NS1 rapid tests, pan-DENV NS1 test,

Fig. 1. NS1 protein alignment and linear epitope mapping of the 10 antibodies used to run the DENV serotype–specific NS1 rapid tests, pan-DENV NS1 test,
Sequence and comparison of the SDS protein.

Sequence and comparison of the SDS protein.
Multiple sequence alignment of S

Multiple sequence alignment of S
Multiple sequence alignment and analysis of SOFL proteins.

Multiple sequence alignment and analysis of SOFL proteins.
(A) Block diagram of the precursor proteins predicted from the Oak1, 2, 3, and 4 clones showing the signal peptide (light shading), the regions corresponding.

(A) Block diagram of the precursor proteins predicted from the Oak1, 2, 3, and 4 clones showing the signal peptide (light shading), the regions corresponding.
Phosphopeptides identified harboring minimal binding motifs

Phosphopeptides identified harboring minimal binding motifs
Alignment of H-NS, H-NS2, and StpA amino acid sequences.

Alignment of H-NS, H-NS2, and StpA amino acid sequences.
STAT Genes Found in C. elegans

STAT Genes Found in C. elegans
Where would you draw the polyA tail in the gene above?______________

Where would you draw the polyA tail in the gene above?______________
Sequence alignment of PHCCEx domains with secondary structure elements of the Tiam2 PHCCEx domain at the top. Sequence alignment of PHCCEx domains with.

Sequence alignment of PHCCEx domains with secondary structure elements of the Tiam2 PHCCEx domain at the top. Sequence alignment of PHCCEx domains with.
Fig. 1 A single amino acid difference in the ATP-binding domain of GSK3α and GSK3β results in structural and topological differences. A single amino acid.

Fig. 1 A single amino acid difference in the ATP-binding domain of GSK3α and GSK3β results in structural and topological differences. A single amino acid.
Identification of the GCS1 ortholog in Gonium pectorale.

Identification of the GCS1 ortholog in Gonium pectorale.
AKAP15 coimmunoprecipitates with CaV1

AKAP15 coimmunoprecipitates with CaV1
Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins and the domains of HB-EGF. Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins.

Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins and the domains of HB-EGF. Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins.
The family of bone morphogenetic proteins

The family of bone morphogenetic proteins
Multiple sequence alignment of STAT6 and other STAT proteins produced by ClusterW and ESpript (espript.ibcp.fr/ESPript/ESPript/). Multiple sequence alignment.

Multiple sequence alignment of STAT6 and other STAT proteins produced by ClusterW and ESpript (espript.ibcp.fr/ESPript/ESPript/). Multiple sequence alignment.

Similar presentations

Ads by Google