Download presentation
Presentation is loading. Please wait.
1
1 7/27/2008 Center for Computational Intelligence, Learning, and Discovery Bioinformatics and Computational Biology Program ROC 2008 meeting A Computational Method to Identify Amino Acid Residues in RNA-protein Interactions Michael Terribilini & Jae-Hyung Lee Cornelia Caragea, Deepak Reyon, Ben Lewis, Jeffry Sander, Robert Jernigan, Vasant Honavar and Drena Dobbs Bioinformatics and Computational Biology Program Center for Computational Intelligence, Learning, and Discovery L.H. Baker Center for Bioinformatics & Biological Statistics BCB NSF IGERT
2
2 7/27/2008 Center for Computational Intelligence, Learning, and Discovery Bioinformatics and Computational Biology Program ROC 2008 meeting PROBLEM: Given the sequence of a protein (& possibly its structure), predict which amino acids participate in protein-RNA interactions APPROACH: Generate datasets of known complexes from PDB to train & test machine learning algorithms (Naïve Bayes, SVM, etc.) GOAL: Classify each amino acid in target protein as either interface or non-interface residue Guiding hypothesis: Principal determinants of protein binding sites are reflected in local sequence features Observation: Binding site residues are often clustered within primary amino acid sequence
3
3 7/27/2008 Center for Computational Intelligence, Learning, and Discovery Bioinformatics and Computational Biology Program ROC 2008 meeting Sequence-Based Classifier: RB181 non-redundant dataset: 181 protein-RNA complexes from the PDB Input: window of amino acid identities centered on target & contiguous in protein sequence Classifier: Naïve Bayes Leave-one-out cross validation QSVSTSSFRYM Ser 28 Structure-Based Classifier: Calculate distance between each pair of residues in known structure Input: identities of the nearest n spatial neighbors Classifier: Naïve Bayes Leave-one-out cross validation SSFRLNKSGRT Ser 28 PSSM-Based Classifier: PSI-BLAST against NCBI nr database to generate PSSMs Input: PSSM vectors for residues contiguous in sequence Classifier: Support Vector Machine (SVM) 10-fold cross validation Ser 28 -3,7,8,… 5,-4,-6, … … … …,5,9,-1,… QSVSTSSFRYM 20 PROBLEM: Given the sequence of a protein (& possibly its structure), predict which amino acids participate in protein-RNA interactions
4
4 7/27/2008 Center for Computational Intelligence, Learning, and Discovery Bioinformatics and Computational Biology Program ROC 2008 meeting Dataset of RNA-protein Interface Residues Extract All Protein-RNA Complexes Select high resolution structures < 3.5Å Res PDB 503 Complexes 181 Chains 48,791 Residues Filter using PISCES < 30% pair-wise sequence identity Identify Interface Residues using distance cutoff 5 Å 7,456 Interface Residues (Positive examples) 41,335 Non-Interface Residues (Negative examples) PISCES: Wang and Dunbrack, 2003 Bioinformatics, 19:1589
5
5 7/27/2008 Center for Computational Intelligence, Learning, and Discovery Bioinformatics and Computational Biology Program ROC 2008 meeting ComplexProtein-ProteinProtein-DNAProtein-RNA Classifier 2-stage classifier SVM + Naïve Bayes Naïve Bayes Accuracy72 %77 %85 % Specificity58 %37 %51 % Sensitivity39 %43 %38 % Correlation coefficient 0.300.250.35 Reference Yan et al., 2004 Bioinformatics Yan et al., 2006 BMC Bioinformatics Terribilini et al., 2006 RNA Related work Jones & Thornton, Ofran & Rost many others Jones et al., Thornton et al., Ahmad & Sarai Jeong et al., Miyano et al., Go et al. Performance in predicting interface residues Using only protein sequence as input
6
6 7/27/2008 Center for Computational Intelligence, Learning, and Discovery Bioinformatics and Computational Biology Program ROC 2008 meeting Na ï ve Bayes 2-stage classifier SVM + Na ï ve Bayes Protein-RNAProtein-DNAProtein-Protein Yan Bioinformatics 2004 ; Yan BMC Bioinformatics 2006 ; Terribilini RNA 2006 Ab FabN10 Acc = 87% CC = 0.65 Repressor Acc = 88% CC = 0.66 dsRNA Binding Protein Acc = 86% CC = 0.59 A few "good" predictions mapped onto structures Using only protein sequence as input
7
7 7/27/2008 Center for Computational Intelligence, Learning, and Discovery Bioinformatics and Computational Biology Program ROC 2008 meeting ID-SeqID-StructID-PSSMCombined 1 Specificity0.550.630.510.53 2 Sensitivity0.300.320.430.49 Accuracy0.860.870.850.86 Correlation Coefficient0.330.38 0.43 3 AUC of ROC0.730.770.790.81 Combining Sequence, Structure & PSSM-Based Classifiers Improves Prediction of RNA-Binding Residues Predictions illustrated on 3D structures: 30S ribosomal protein S17 (PDB ID 1FJG:Q) Sequence-BasedStructure-BasedPSSM-Based Combined (For clarity, bound RNA is not shown) TP = True Positive = interface residues predicted as such FP = False Positive = non-interface residues predicted as interface residues TN = True Negative = non-interface residues predicted as such FN = False Negative = interface residues predicted as non-interface Combined Results for 1FJG:Q: Spec+ = 0.89 Sens+ = 0.96 Accuracy = 0.91 Correlation Coefficient = 0.83 1 Specificity (Precision for the positive, RNA-binding class) 2 Sensitivity (Recall for the positive, RNA-binding class) 3 Area Under the Curve (AUC) from a Receiver Operating Characteristic (ROC) curve
8
8 7/27/2008 Center for Computational Intelligence, Learning, and Discovery Bioinformatics and Computational Biology Program ROC 2008 meeting IDSeq Predictions Accuracy = 80% Specificity = 56% Sensitivity = 21% CC = 0.25 Combined Predictions Accuracy = 82% Specificity = 55% Sensitivity = 75% CC = 0.52 Predictions for Signal Recognition Particle 19kDa protein (PDB ID 1JID_A)
9
9 7/27/2008 Center for Computational Intelligence, Learning, and Discovery Bioinformatics and Computational Biology Program ROC 2008 meeting RNABindR: An RNA Binding Site Prediction Server
10
10 7/27/2008 Center for Computational Intelligence, Learning, and Discovery Bioinformatics and Computational Biology Program ROC 2008 meeting Applications Lentiviral Rev proteins Telomerase Reverse Transcriptase (TERT) http://telomerase.asu.edu/
11
11 7/27/2008 Center for Computational Intelligence, Learning, and Discovery Bioinformatics and Computational Biology Program ROC 2008 meeting Rev - a potential target for novel HIV therapies Rev is a multifunctional regulatory protein that plays an essential role in the production of infectious virus A small nucleo-plasmic shuttling protein (HIV Rev 115 aa; EIAV Rev 165 aa) Recognizes a specific binding site on viral RNA Rev Responsive Element (RRE) Contains specific domains that mediate nuclear localization, RNA binding and nuclear export Rev's critical role in lentiviral replication makes it an attractive target for antiviral (AIDs) therapy
12
12 7/27/2008 Center for Computational Intelligence, Learning, and Discovery Bioinformatics and Computational Biology Program ROC 2008 meeting Why? –Rev aggregates at concentrations needed for NMR or X- ray crystallography –The only high resolution information available is for short peptide fragments of HIV-1 Rev: a 22 amino acid fragment of Rev bound to a 34 nucleotide RRE RNA fragment What about insights from sequence comparisons? –HIV Rev sequence has low sequence identity with proteins with known structure –Very little sequence similarity among different Rev family members (e.g., EIAV vs HIV < 10%) Problem: no high resolution Rev structure! - not even for HIV Rev, despite intense effort
13
13 7/27/2008 Center for Computational Intelligence, Learning, and Discovery Bioinformatics and Computational Biology Program ROC 2008 meeting HIV-1 Rev: Predictions vs Experiments Prediction on RNA-binding protein HIV-1 Rev 33 43 53 DTRQARRNRR RRWRERQRAA AA ++++++++++ ++++++++ Actual IR Predicted Sequence based prediction on HIV-1 Rev (not included in the training set) identified every interface residue, plus 3 false positives Predicted Actual NMR structure (1ETF:B): 22 aa Rev peptide bound to RNA Battiste et al., 1996,Science 273:1547 Interface residues = red Non-interface residues = grey RNA = green
14
14 7/27/2008 Center for Computational Intelligence, Learning, and Discovery Bioinformatics and Computational Biology Program ROC 2008 meeting PREDICTED: Structure Protein binding residues RNA binding residues KRRRK RRDRW EIAV Rev: Predictions vs Experiments + + 131 141 151 161 QRGDFSAWGDYQQAQERRWGEQSSPRVLRPGDS KRRRK HL ++++++++++ ++ +++ ++++ ++ 61 71 81 91 ARRHLGPGPTQHTPS RRDRW IREQILQAEVLQ ERLE WRI +++++++++++++++ +++++++++++++ +++ 41 51 GP L ESDQWCRV L RQS L PEEKISSQTCI ++ + +++++ + + RRDRW ERLE KRRRK NES NLS 57 125145 165 31 Lee J Virol 2006; Terribilini RNA 2006 VALIDATED: Protein binding residues RNA binding residues 57-165 MBP WT 31-16531-145 145-165 Ihm Ho Carpenter
15
15 7/27/2008 Center for Computational Intelligence, Learning, and Discovery Bioinformatics and Computational Biology Program ROC 2008 meeting AADAA AALA KAAAK ERDE RRDRW ERLE KRRRK NES NLS 57 125145 165 31 KAAAK AADAA AALA ERDE WT 131 141 151 161 QRGDFSAWGDYQQAQERRWGEQSSPRVLRPGDS KRRRK HL ++++++++++ ++ +++ ++++ ++ 61 71 81 91 ARRHLGPGPTQHTPS RRDRW IREQILQAEVLQ ERLE WRI +++++++++++++++ +++++++++++++ +++ 41 51 GP L ESDQWCRV L RQS L PEEKISSQTCI ++ + +++++ + + Mutations in EIAV Rev: Experimental evaluation of RNA binding sites Lee J Virol 2006; Terribilini RNA 2006
16
16 7/27/2008 Center for Computational Intelligence, Learning, and Discovery Bioinformatics and Computational Biology Program ROC 2008 meeting Summary KRRRK RRDRW HIV-1 Rev EIAV Rev Results show predicted protein & RNA binding sites in Rev proteins of HIV-1 & EIAV agree with available experimental data
17
17 7/27/2008 Center for Computational Intelligence, Learning, and Discovery Bioinformatics and Computational Biology Program ROC 2008 meeting Telomerase Reverse Transcriptase (TERT) Functions: –“ Cap ” ends of chromosomes to prevent: – Recombination – End-to-end fusion – Degradation –Allow complete replication of chromosomes Interactions: Protein-DNA –Binds linear chromosome ends (& extends them) Protein-RNA –Telomerase reverse transcriptase (TERT) subunit contains an essential RNA component Protein-Protein –Dyskerin - component of active human telomerase complex –Many other interacting proteins: e.g., PPI1, RAP1, TEP1, HSP90 Lingner (1997) Science 276: 561-567 Adapted from P. J. Mason
18
18 7/27/2008 Center for Computational Intelligence, Learning, and Discovery Bioinformatics and Computational Biology Program ROC 2008 meeting Human TERT: Preliminary docking of 3 modeled domains Preliminary model (lacking TEN domain) Kurcinski Kolinski Kloczkowski
19
19 7/27/2008 Center for Computational Intelligence, Learning, and Discovery Bioinformatics and Computational Biology Program ROC 2008 meeting Predicted vs Actual RNA-Binding Residue in Human TRBD PredictedActual
20
20 7/27/2008 Center for Computational Intelligence, Learning, and Discovery Bioinformatics and Computational Biology Program ROC 2008 meeting Current & future work Future: –Experimentally interrogate protein-RNA interfaces suggested by this work –Investigate these interfaces as potential therapeutic targets Progress towards our Goals? √ Model TERT domains from human √ Dock domains to generate a complete model for TERT protein Generate a working model for TERT-TR complex Predict TR RNA tertiary structure, then dock with protein Underway…
21
21 7/27/2008 Center for Computational Intelligence, Learning, and Discovery Bioinformatics and Computational Biology Program ROC 2008 meeting Conclusions A combined classifier that uses the query sequence plus additional information derived from the known structure & a PSSM generated using PSI-BLAST sequence homologs (trained and tested on RB181, a dataset of diverse protein-RNA interfaces), predicts interface residues with ~ 86% overall accuracy, CC = 0.43 Combining structure prediction with machine learning has potential to provide valuable insights into structure & function of important large RNP complexes - especially those for which high-resolution experimental structural information is not yet available Computational methods can provide insight into protein-RNA interfaces, even for "recalcitrant" proteins whose structures are not yet available
22
22 7/27/2008 Center for Computational Intelligence, Learning, and Discovery Bioinformatics and Computational Biology Program ROC 2008 meeting Acknowledgements Dobbs Lab @ Iowa State University http://ddobbs.public.iastate.edu/ Drena Dobbs, BCB & GDCB –Michael Terribilini –Jeffry Sander –Peter Zaback –Deepak Reyon –Ben Lewis Kolinski Lab @ University of Warsaw http://biocomp.chem.uw.edu.pl/ Andrzej Kolinski, Chemistry –Mateusz Kurcinski @ Iowa State University Andrzej Kloczkowski, BBMB Robert Jernigan, BBMBKai-Ming Ho, Physics Supported by: NSF IGERT Computational Molecular Biology USDA MGET Animal Genomics Iowa State University: Bioinformatics & Computational Biology Program (BCB) LH Baker Center for Bioinformatics & Biological Statistics Center for Integrated Animal Genomics (CIAG) Center for Computational Intelligence, Learning & Discovery (CILD) Honavar Lab @ Iowa State University http://www.cs.iastate.edu/~honavar/aigroup.htm Vasant Honavar, BCB & Computer Science –Cornelia Caragea @ Washington State University Susan Carpenter, Vet Micro & Patho @ UCLA Yungok Ihm, Biochemistry
Similar presentations
© 2025 SlidePlayer.com. Inc.
All rights reserved.