Presentation is loading. Please wait.

Presentation is loading. Please wait.

Protein Structure July 2, 2006 Learning objectives-Understand the basis of the secondary structure prediction program- Psi-PRED. Introduce the concept.

Similar presentations


Presentation on theme: "Protein Structure July 2, 2006 Learning objectives-Understand the basis of the secondary structure prediction program- Psi-PRED. Introduce the concept."— Presentation transcript:

1 Protein Structure July 2, 2006 Learning objectives-Understand the basis of the secondary structure prediction program- Psi-PRED. Introduce the concept of a neural network and how a neural network can help to predict secondary structure. Become familiar with motif finding programs. Become familiar with the Protein Data Bank. Workshop-Analysis of p53 with Psi-PRED and analysis of PTEN protein with BLIMPs.

2 Some Prediction Methods ab initio methods Based on physical properties of aa’s and bonding patterns Statistics of amino acid distributions in known structures Chou-Fasman Position of amino acid and distribution Garnier, Osguthorpe-Robeson (GOR) Neural networks

3 GOR (Garnier, Osguthorpe- Robeson) Position-dependent propensities for helix, sheet or turn is calculated for each amino acid. For each position j in the sequence, eight residues on either side of aa j is considered. A helix propensity table contains info. about propensity for certain residues at 16 other positions when the conformation of residue j is helical. The helix propensity table has 20 x 17 entries. The predicted state of aa j is calculated as the sum of the position-dependent propensities of all residues around aa j. aa j

4 Psi-BLAST Predict Secondary Structure (PSIPRED) Three stages: 1) Generation of sequence profile 2) Prediction of initial secondary structure 3) Filtering of predicted structure

5 PSIPRED Uses multiple aligned sequences for prediction. Created the sequence weights using a training set of folds with known structure. Used a two-stage neural network to predict structure based on position specific scoring matrices generated by Psi-BLAST (Jones, 1999) First network converted a window of 15 aa’s into a raw score of h,e (sheet), c (coil) or terminus Second network filtered the first output. For example, an output of hhhhehhhh might be converted to hhhhhhhhh. Obtained a Q 3 value of 70-78% (may be the highest achievable)

6 What is Q 3?  Predicted Output x 100  Actual Output Q 3 =

7 Neural networks Computer neural networks are based on simulation of adaptive learning in networks of real neurons. Neurons connect to each other via synaptic junctions which are either stimulatory or inhibitory. Adaptive learning involves the formation or suppression of the right combinations of stimulatory and inhibitory synapses so that a set of inputs produce an appropriate output.

8 Neural Networks (cont. 1) The computer version of the neural network involves identification of a set of inputs - amino acids in the sequence, which transmit through a network of connections. At each layer, inputs are numerically weighted and the combined result passed to the next layer. Ultimately a final output, a decision, helix, sheet or coil, is produced.

9 PSIPRED 90% of training set was used (known structures) 10% was used to evaluate the performance of the neural network during the training session.

10 PSIPRED During the training phase, selected sets of proteins of known structure are scanned, and if the decisions are incorrect, the input weightings are adjusted by the software to produce the desired result. Training runs are repeated until the success rate is maximized. Careful selection of the training set is an important aspect of this technique. The set must contain as wide a range of different fold types as possible without duplications of structural types that may bias the decisions.

11 PSIPRED An additional component of the PSIPRED procedures involves sequence alignment with similar proteins. The rationale is that some amino acids positions in a sequence contribute more to the final structure than others. (This has been demonstrated by systematic mutation experiments in which each consecutive position in a sequence is substituted by a spectrum of amino acids. Some positions are remarkably tolerant of substitution, while others have unique requirements.) To predict secondary structure accurately, one should place little weight on the tolerant positions, which clearly contribute little to the structure, and strongly emphasize the intolerant positions.

12 15 groups of 21 units (1 unit for each aa plus one specifying the end) Row specifies aa position three outputs are helix, strand or coil Filtering network Provides info on tolerant or intolerant positions 4 4

13 Example of Output from PSIPRED PSIPRED PREDICTION RESULTS Key Conf: Confidence (0=low, 9=high) Pred: Predicted secondary structure (H=helix, E=strand, C=coil) AA: Target sequence Conf: 923788850068899998538983213555268822788714786424388875156215 Pred: CCEEEEEEEHHHHHHHHHHCCCCCCHHHHHHCCCCCEEEEECCCCCCHHHHHHHCCCCCC AA: KDIQLLNVSYDPTRELYEQYNKAFSAHWKQETGDNVVIDQSHGSQGKQATSSVINGIEAD 10 20 30 40 50 60

14 Recognizing motifs in proteins. PROSITE is a database of protein families and domains. Most proteins can be grouped, on the basis of similarities in their sequences, into a limited number of families. Proteins or protein domains belonging to a particular family generally share functional attributes and are derived from a common ancestor.

15 PROSITE Database Contains 1087 different proteins and more than 1400 different patterns/motifs or signatures. A “signature” of a protein allows one to match a protein to a specific function based on structure and/or function. An example of an entry in PROSITE is: http://ca.expasy.org/cgi-bin/nicedoc.pl?PDOC50020

16 How are the profiles constructed in the first place? ALRDFATHDDVCGK.. SMTAEATHDSVACY.. ECDQAATHEAVTHR.. Sequences are aligned manually by expert in field. Then a profile is created. A-T-H-[DE]-X-V-X(4)-{ED} This pattern is translated as: Ala, Thr, His, [Asp or Glu], any, Val, any, any, any, any, any but not Glu or Asp

17 Example of a PROSITE record ID ZINC_FINGER_C3HC4; PATTERN. PA C-X-H-X-[LIVMFY]-C-X(2)-C-[LIVMYA]

18 PROSITE Database FindProfile is a program that searches the Prosite database. It uses dynamic programming to determine optimal alignments. If the alignment produces a high score, then the match is given. If a “hit” is obtained the program gives an output that shows the region of the query that contains the pattern and a reference to the 3-D structure database if available.

19 Example of output from FindProfile

20 Other algorithms that search for protein patterns. BLIMPs-A program that uses a query sequence to search the BLOCKs database. (written by Bill Alford) BLOCKs- database of multiply aligned ungapped segments corresponding to the most highly conserved regions of proteins. The blocks that comprise the BLOCKs Database are made automatically by searching for the most highly conserved regions in groups of proteins documented in the Prosite Database and other databases.

21 Example of entry in BLOCKS database ID p99.1.2414; BLOCK AC BP02414A; distance from previous block=(29,215) DE PROTEIN ZINC-FINGER NUCLEAR FIN BL LCC; width=27; seqs=8; 99.5%=1080; strength=1292 RPT1_MOUSE|P15533 ( 101) EKLRLFCRKDMMVICWLCERSQEHRGH 62 Y129_HUMAN|Q14142 ( 30) RVAELFCRRCRRCVCALCPVLGAHRGH 100 RFP_HUMAN|P14373 ( 101) EPLKLYCEEDQMPICVVCDRSREHRGH 49 RFP_MOUSE|Q62158 ( 110) EPLKLYCEQDQMPICVVCDRSREHRDH 51 RO52_HUMAN|P19474 ( 97) ERLHLFCEKDGKALCWVCAQSRKHRDH 54 RO52_MOUSE|Q62191 ( 101) EKLHLFCEEDGQALCWVCAQSGKHRDH 52 TF1B_HUMAN|Q13263 ( 215) EPLVLFCESCDTLTCRDCQLNAHKDHQ 65 TF1B_MOUSE|Q62318 ( 216) EPLVLFCESCDTLTCRDCQLNAHKDHQ 65 Median of standardized scores for true positives Min and max dist to next block Family description Sequence weight (higher number is more distant) Start position of the sequence segment

22 How does BLIMPS search the BLOCKS database? It transforms each block into a position specific scoring matrix (PSSM). Each PSSM column corresponds to a block position and contains values based on frequency of occurrence at that position. A comparison is made between the query sequence and the BLOCK by sliding the PSSM over the query. For every alignment each sequence position receives a score. This sliding window procedure is repeated for all BLOCKS in the database.

23 Example of a pattern search using BLIMPS Note that any score less than 1000 may be due to chance. The score above 1000 is a score that is better than 95.5% of the true negatives.

24 3D structure data The largest 3D structure database is the Protein Database It contains over 15,000 records Each record contains 3D coordinates for macromolecules 80% of the records were obtained from X-ray diffraction studies, 16% from NMR and the rest from other methods and theoretical calculations

25 ATOM 1 N ARG A 14 22.451 98.825 31.990 ATOM 2 CA ARG A 14 21.713 100.102 31.828 ATOM 3 C ARG A 14 22.583 101.018 30.979 ATOM 4 O ARG A 14 22.105 101.989 30.391 ATOM 5 CB ARG A 14 21.424 100.704 33.208 ATOM 6 CG ARG A 14 20.465 101.880 33.215 ATOM 7 CD ARG A 14 20.008 102.147 34.637 ATOM 8 NE ARG A 14 18.999 103.196 34.718 ATOM 9 CZ ARG A 14 18.344 103.507 35.833 ATOM 10 NH1 ARG A 14 18.580 102.835 36.952 ATOM 11 NH2 ARG A 14 17.441 104.479 35.827 Part of a record from the PDB


Download ppt "Protein Structure July 2, 2006 Learning objectives-Understand the basis of the secondary structure prediction program- Psi-PRED. Introduce the concept."

Similar presentations


Ads by Google