Presentation is loading. Please wait.

Presentation is loading. Please wait.

Vermont Genetics Network Outreach Proteomics Module

Similar presentations


Presentation on theme: "Vermont Genetics Network Outreach Proteomics Module"— Presentation transcript:

1 Vermont Genetics Network Outreach Proteomics Module
Protein Mass Spectrometry: Theory and Application Prepared by Bryan A. Ballif, Ph.D.

2 Two Essential Partner Tools in Proteomics
Mass Spectrometry Gel Electrophoresis

3 First Things First -- Know Your Goal !
● There are nearly as many mass spectrometry methods as there are mass spectrometry projects. ● Your goal determines your methods which determine your outcomes.

4 The Four Most Common Protein Mass Spectrometry Projects
(Observe How Each Project Has A Distinct Goal / Method !!) Where Is this protein Post-translationally Modified? Stimulus Block Western Blot α-pS What protein Changes occur Following ______? Stimulus H2O2 Block Western Blot α-pY Purify pY Proteins Identify pY Proteins Identify pY Sites Quantify pY Changes What is this protein? What proteins are present in _____? Rat eCSF

5 Typical Protein Mass Spectrometry Work Flow
Protein Preparation / Analyte Preparation Junk In … Junk Out ! Mass Spectrometry Data Analysis / Interpretation

6 Most Proteomics Experiments Further Purify the Analyte Using
High Performance Liquid Chromatography (HPLC) Organic Solvent H2O HPLC pumps Mass Spectrometer Carbon Column Electric / Magnetic Fields

7 Two Common Types of Peptide Ionization
Matrix-Assisted Laser Desorption Ionization (MALDI) Electrospray Ionization John Fenn (2002 Nobel Prize) Koichi Tanaka (2002 Nobel Prize)

8 Perhaps the Most Simple Concept for
Mass Measurements in Mass Spectrometer Remember there are relationships between mass and Energy : E = mc2 or Ek = ½ mv2 Time of Flight Mass Spectrometry Electric field gives ions defined kinetic energy. Image from Kore Technology Limited Ekinetic = ½ mv2

9 Peptides (Bottom Up Proteomics) Versus Protein (Top Down)
Tryptic Digest MFSCFLQAGNPQGSRSGFGHNVELVRHASIWVTYHSEEKLLIPYSDEL MFSCFLQAGNPQGSR SGFGHNVELVR HASIWVTYHSEEK LLIPYSDEL

10 Multiple Peptides may have the same Mass!
Another Problem: Multiple Peptides may have the same Mass! NH3 G-F-S-F-P-V-A-T-G-L-M-E-D COOH D-G-K-P-R - NH3 G-F-S-F-P-M-L-G-T-A-V-E-D COOH D-G-K-P-R -

11 Basics of Liquid Chromatography (LC)
Tandem Mass Spectrometry (MS/MS) for Peptides HPLC pumps Mass Spectrometer LC MS1 MS2 Peptide Ions Peptide Fragment Ions Relative Abundance time organic concentration in mobile phase Relative Abundance m/z m/z low high

12 Knowing your ABC’s and your XYZ’s:
In your “Daughter” or “Fragment” Ions

13 A Closer Look at MS2 (For Peptide Identification)
He He 1 2 3 4 5 Y ions 6 7 8 9 10 b ions 1 2 3 4 5 Y ions NH3 G-F-S-F-P-V-A-T-G-L-M-E-D G-F-S-F-P-V-A-T-G-L-M-E-D-D-G-K-P-R COOH NH3 - COOH D-G-K-P-R 1 2 3 4 5 6 7 8 9 10 11 12 13 b ions Collision- Induced Dissociation ( CID )

14 A Closer Look at MS2 (and Phosphorylation )
He - G-F-S-F-P-V-A-T-G-L-M-E-D-D-G-K-P-R NH3 COOH


Download ppt "Vermont Genetics Network Outreach Proteomics Module"

Similar presentations


Ads by Google