Presentation is loading. Please wait.

Presentation is loading. Please wait.

teammates: Liu Lanxuan Yin Jianmin

Similar presentations


Presentation on theme: "teammates: Liu Lanxuan Yin Jianmin"— Presentation transcript:

1 teammates: Liu Lanxuan Yin Jianmin
A Simple Anaylsis of Phenylpropanoid Pathway From the point of view of structure teammates: Liu Lanxuan Yin Jianmin

2 procedure introduction of pathway and enzymes preparation of materials
homology modelling protein-ligand docking protein-protein docking summary and scope

3 introduction pathway: phenylpropanoid pathway enzymes:
cytochrome P450 and other enzyems

4 Vogt, T. (2009). "Phenylpropanoid Biosynthesis
Vogt, T. (2009). "Phenylpropanoid Biosynthesis." Molecular Plant 3(1): 2-20.

5 The plant shikimate pathway is the
entry to the biosynthesis of phenylpropanoids. phenylpropanoid derived metabolites comprise and contribute to multiple biosynthetic branches other than lignin and flavonoid biosynthesis only Vogt, T. (2009). "Phenylpropanoid Biosynthesis." Molecular Plant 3(1): 2-20.

6 The phenylpropanoid pathway provides pre-cursors for lignin in Arabidopsis
source:KEGG

7 In the last decade, knockout mutations and RNAi-mediated suppression in Arabidopsis and
other model plants have facilitated the identification and functional characterization of genes and enzymes

8 enzymes cytochrome P450: CYP84A1:ferulic acid 5-hydroxylase
CYP73A5:trans-cinnamate 4-monooxygenase CYP98A3:coumaroylquinate(coumaroylshikimate) 3'-monooxygenase other enzymes: HCT:hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase PAL:phenylalanine ammonia-lyase 4CL:4-coumarate--CoA ligase ...

9 cytochrome P450 Plant systems utilize a diverse array of cytochrome P450 monooxygenases (P450s) in their biosynthetic and detoxicative pathways. Those P450s in biosynthetic pathways play critical roles in the synthesis of lignins, UV protectants, pigments, defense compounds, fatty acids, hormones, and signaling molecules. Those in catabolic pathways participate in the breakdown of endogenous compounds and toxic compounds encountered in the environment. Schuler, M. A. and D. Werck-Reichhart (2003). "Functional genomics of P450s." Annual Review of Plant Biology 54:

10 At present,5100 sequences of plant cytochrome P450s(CYPs) have been annotated and named.The 5100 sequences include 3651 CYPs from 11 fully sequenced plant genomes:Arabidopsis, papaya, grapevine, soybean, tomato, rice,Brachypodium distachyon, Selaginella moellendorffii(lycopod), Physcomitrella patens (moss), Chlamydomonas reinhardtii and Volvox carteri (colonial green algae)An additional 1449 CYP sequences are named from 255 incompletely sequenced plant species with 1–183 sequences Named sequences can be found at the Cytochrome P450 Homepage: Nelson, D. and D. Werck-Reichhart (2011). "A P450-centric view of plant evolution." Plant Journal 66(1):

11 Meunier, B. , S. P. de Visser, et al. (2004)
Meunier, B., S. P. de Visser, et al. (2004). "Mechanism of oxidation reactions catalyzed by cytochrome P450 enzymes." Chemical Reviews 104(9):

12 Schoch, G. , S. Goepfert, et al. (2001)
Schoch, G., S. Goepfert, et al. (2001). "CYP98A3 from Arabidopsis thaliana is a 3 '-hydroxylase of phenolic esters, a missing link in the phenylpropanoid pathway." Journal of Biological Chemistry 276(39):

13 prepare materials after searching PDB database, we found only one single enzyme(CAD) that has 3D structrue(based on Arabidopsis),in order to perform homology modelling we downloaded the sequences of CYP98A3,CYP73A5,CYP84A1 in the phenlypropanoid pathway of Arabidopsis

14 sequence >cyp73a5 cyp98a3 cyp84a1 HCT PAL 4CL
MDLLLLEKSLIAVFVAVILATVISKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRMGQRNLVVVSSPDLTKEVLLTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQNREGWEFEAASVVEDVKKNPDSATKGIVLRKRLQLMMYNNMFRIMFDRRFESEDDPLFLRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICQDVKDRRIALFKKYFVDERKQIASSKPTGSEGLKCAIDHILEAEQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQSKLRNELDTVLGPGVQVTEPDLHKLPYLQAVVKETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERFFEEESHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKVDTSEKGGQFSLHILNHSIIVMKPRNC cyp98a3 cyp84a1 HCT PAL 4CL ...

15 Low sequence similarity
sequence alignment of CYP98A3/CYP84A1/CYP73A5 Low sequence similarity high structure conservation

16 homology modelling blast search sequence analysis load templates
creating model align model to template

17 blast search cyp98a3 as example

18 loaded templates structures
3RUKA 3QZ1A 3QM4A

19 create models among several model,we pick
the single one that has the high- est score as our result

20 CYP98A3 CYP73A5 CYP84A1 4CL HCT CCR PAL CCoAOMT Sequence identity 14.1% 10.2% 7.6% 15.2% 10.7% 14.3% 5.7% 18.2% Sequence similarity 34.8% 28.5% 20.1% 26.4% 22.6% 31.9% 15.7% 36%

21 align structure to templates
CCoAOMT 36% PAL 15.7%

22 protein-ligand docking
method:CDOCKER(DS) materials: CYP73A5+substrate CYP98A3+substrate CYP84A1+substrate

23 ligands Rupasinghe, S., J. Baudry, et al. (2003). "Common active site architecture and binding strategy of four phenylpropanoid P450s from Arabidopsis thaliana as revealed by molecular modeling." Protein Engineering 16(10):

24 binding strategy Rupasinghe, S., J. Baudry, et al. (2003). "Common active site architecture and binding strategy of four phenylpropanoid P450s from Arabidopsis thaliana as revealed by molecular modeling." Protein Engineering 16(10):

25 SRS sequence alignment
Rupasinghe, S., J. Baudry, et al. (2003). "Common active site architecture and binding strategy of four phenylpropanoid P450s from Arabidopsis thaliana as revealed by molecular modeling." Protein Engineering 16(10):

26 CDOCKER cyp98a3: site 10 cyp73a5: site2

27 protein-protein docking
method:ZDOCK(DS) materials: CYP98A PAL CYP73A HCT CYP84A CCR CAD CCR...

28 protein-protein interacion with cytochrome P450
CYP450-CYP450 CYP450-CPR CYP450 N terminus ER CPR C terminus Subramanian, M., H. Tam, et al. (2010). "CYP2C9-CYP3A4 Protein-Protein Interactions: Role of the Hydrophobic N Terminus." Drug Metabolism and Disposition 38(6): Subramanian, M., M. Low, et al. (2009). "CYP2D6-CYP2C9 Protein-Protein Interactions and Isoform-Selective Effects on Substrate Binding and Catalysis." Drug Metabolism and Disposition 37(8): Localization of Cinnamic Acid 4-Monooxygenase and the Membrane-bound Enzyme System for Dhurrin Biosynthesis in Sorghum Seedlings' Received for publication May 11, 1977 and in revised form June 27, 1977 JAMES A. SAUNDERS, ERIC E. CONN, CHIN Ho LIN, AND MIKIO SHIMADA3 Department of Biochemistry and Biophysics, University of California, Davis, California 95616

29 potential protein-protein interaction of cytochrome P450 in phenylpropanoid pathway
C4H-PAL C3H-HCT C4H-F5H F5H-COMT Localization of Cinnamic Acid 4-Monooxygenase and the Membrane-bound Enzyme System for Dhurrin Biosynthesis in Sorghum Seedlings' Received for publication May 11, 1977 and in revised form June 27, 1977 JAMES A. SAUNDERS, ERIC E. CONN, CHIN Ho LIN, AND MIKIO SHIMADA3 Department of Biochemistry and Biophysics, University of California, Davis, California 95616 Bassard, J.-E., J. Mutterer, et al. (2012). "A novel method for monitoring the localization of cytochromes P450 and other endoplasmic reticulum membrane associated proteins: a tool for investigating the formation of metabolons." FEBS Journal 279(9): Fraser (2011). "The Phenylpropanoid Pathway in Arabidopsis." The Arabidopsis Book

30

31

32 cyp84a1-PAL cyp73a5-PAL

33 pi-cation HBond pi-pi pi-sigma CYP7A35-PAL (pose99_Cluster9)

34 others are still running...
CYP84A1-HCT CYP98A3-HCT CYP73A5-HCT CYP84A1-PAL CYP98A3-PAL CYP73A5-PAL CYP84A1-CCR CYP98A3-CCR CYP73A5-CCR CYP84A1-CAD CYP98A3-CAD CYP73A5-CAD CYP84A1-4CL CYP98A3-4CL CYP73A5-4CL others are still running...

35 summary and scope summary: (1)catalysis mechanism of CYP450
(2)binding strategy of CYP450 and its substrate (3)potential protein-protein interaction of phenylpropanoid pathway (4)necessary docking(CDOCKER/ZDOCK)

36 summary and scope scope:
(1)analyze the docking models to find something interesting and valuable (2)perform how protein-protein interaction affect the catalysis mechanism of CYP450 (3)write a paper

37 项目分工: 文献挖掘+PPT制作:刘岚轩 同源建模+对接模型:尹建民 Thank You!!


Download ppt "teammates: Liu Lanxuan Yin Jianmin"

Similar presentations


Ads by Google