Download presentation
Presentation is loading. Please wait.
Published byWinifred Holland Modified over 9 years ago
1
13.1 בשבועות הקרובים יתקיים סקר ההוראה (באתר מידע אישי לתלמיד)באתר מידע אישי לתלמיד סקר הוראה
2
13.2 BioPerl
3
12.3 The BioPerl project is an international association of developers of open source Perl tools for bioinformatics, genomics and life science research. Things you can do with BioPerl: Read and write sequence files of different format, including: Fasta, GenBank, EMBL, SwissProt and more … Extract gene annotation from GenBank, EMBL, SwissProt files Read and analyse BLAST results. Read and process phylogenetic trees and multiple sequence alignments. Analysing SNP data. And more … BioPerl
4
12.4 BioPerl BioPerl modules are called Bio::XXX You can use the BioPerl wiki: http://bio.perl.org/ with documentation and examples for how to use them – which is the best way to learn this. We recommend beginning with the "How-tos": http://www.bioperl.org/wiki/HOWTOs http://www.bioperl.org/wiki/HOWTOs To a more hard-core inspection of BioPerl modules: BioPerl 1.6.1 Module Documentation
5
12.5 Many packages are meant to be used as objects. In Perl, an object is a data structure that can use subroutines that are associated with it. We will not learn object oriented programming, but we will learn how to create and use objects defined by BioPerl packages. Object-oriented use of packages $obj 0x225d14 func() anotherFunc()
6
12.6 BioPerl modules are named Bio::xxxx The Bio::SeqIO module deals with Seq uences I nput and O utput: We will pass arguments to the new argument of the file name and format use Bio::SeqIO; my $in = Bio::SeqIO->new("-file" => " "GenBank"); BioPerl: the SeqIO module File argument (filename as would be in open ) A list of all the sequence formats BioPerl can read is in: http://www.bioperl.org/wiki/HOWTO:SeqIO#Formats http://www.bioperl.org/wiki/HOWTO:SeqIO#Formats Format argument $in 0x25e211 next_seq() write_seq()
7
12.7 use Bio::SeqIO; my $in = Bio::SeqIO->new("-file" => " "GenBank"); my $seqObj = $in->next_seq(); BioPerl: the SeqIO module $in 0x25e211 next_seq() write_seq() next_seq() returns the next sequence in the file as a Bio::Seq object (we will talk about them soon) Perform next_seq() subroutine on $in You could think of it as: SeqIO::next_seq($in)
8
12.8 use Bio::SeqIO; my $in = Bio::SeqIO->new("-file" => "<adeno12.gb", "-format" => "GenBank"); my $out = Bio::SeqIO->new("-file" => ">adeno12.out.fas", "-format" => "Fasta"); my $seqObj = $in->next_seq(); while ( defined($seqObj) ){ $out->write_seq($seqObj); $seqObj = $in->next_seq(); } BioPerl: the SeqIO module write_seq() write a Bio::Seq object to $out according to its format
9
12.9 use Bio::SeqIO; my $in = Bio::SeqIO->new( "-file" => "<Ecoli.prot.fasta", "-format" => "Fasta"); my $seqObj = $in->next_seq(); while (defined($seqObj)) { print "ID:".$seqObj->id()."\n"; #1st word in header print "Desc:".$seqObj->desc()."\n"; #rest of header print "Sequence:".$seqObj->seq()."\n"; #seq string print "Length:".$seqObj->length()."\n";#seq length $seqObj = $in->next_seq() } You can read more about the Bio::Seq subroutines in: http://www.bioperl.org/wiki/HOWTO:Beginners#The_Sequence_Object BioPerl: the Seq module
10
12.10 Print last 30aa of each sequence (no BioPerl) open (IN, "<seq.fasta") or die "Cannot open seq.fasta..."; my $fastaLine = ; while (defined $fastaLine) { chomp $fastaLine; # Read first word of header if (fastaLine =~ m/^>(\S*)/) { my $header = substr($fastaLine,1); $fastaLine = ; } # Read seq until next header my $seq = ""; while ((defined $fastaLine) and(substr($fastaLine,0,1) ne ">" )) { chomp $fastaLine; $seq = $seq.$fastaLine; $fastaLine = ; } # print last 30aa my $subseq = substr($seq,-30); print "$header\n"; print "$subseq\n"; }
11
12.11 Now using BioPerl use Bio::SeqIO; my $in = Bio::SeqIO->new("-file"=>" "Fasta"); my $seqObj = $in->next_seq(); while (defined($seqObj)) { # Read first word of header my $header = $seqObj->id(); # print last 30aa my $seq = $seqObj->seq(); my $subseq = substr($seq,-30); print "$header\n"; print "$subseq\n"; $seqObj = $in->next_seq(); } Note: BioPerl warnings about: Subroutine... redefined at... Should not trouble you, it is a known issue – it is not your fault and won't effect your script's performances.
12
12.12 Now using BioPerl use Bio::SeqIO; my $in = Bio::SeqIO->new("-file"=>" "Fasta"); my $seqObj; while (defined ($seqObj= $in->next_seq()) ) { # Read first word of header my $header = $seqObj->id(); # print last 30aa my $seq = $seqObj->seq(); my $subseq = substr($seq,-30); print "$header\n"; print "$subseq\n"; } or alternatively
13
13.13 Class exercise 13a 1.Use Bio::SeqIO to read a FASTA file and print to an output FASTA file only sequences shorter than 3,000 bases. (use the EHD nucleotide FASTA from the webpage) 2.Use Bio::SeqIO to read a FASTA file, and print (to the screen) header lines that contain the words " Mus musculus ". 3*.Write a script that uses Bio::SeqIO to read a GenPept file and convert it to FASTA. (use preProInsulinRecords.gp from the webpage)preProInsulinRecords.gp 4*.Same as Q1, but print to the FASTA the reverse complement of each sequence. (Do not use the reverse or tr// functions! BioPerl can do it for you - read the BioPerl documentation).
14
12.14 The Bio::DB::Genbank module allows us to download a specific record from the NCBI website: use Bio::DB::GenBank; my $gb = Bio::DB::GenBank->new; my $seqObj = $gb->get_Seq_by_acc("J00522"); print $seqObj->seq(); see more options in: http://www.bioperl.org/wiki/HOWTO:Beginners#Retrieving_a_sequence_from_a_database http://doc.bioperl.org/releases/bioperl-1.4/Bio/DB/GenBank.html BioPerl: downloading files from the web
15
12.15 BLAST Congrats, you just sequenced yourself some DNA. And you want to see if it exists in any other organism # $?!?
16
12.16 BLAST BLAST helps you find similarity between your sequence and other sequences BLAST - Basic Local Alignment and Search Tool
17
12.17 BLAST BLAST helps you find similarity between your sequence and other sequences BLAST - Basic Local Alignment and Search Tool
18
12.18 BLAST BLAST helps you find similarity between your sequence and other sequences
19
12.19 BLAST Database query hit high scoring pair (HSP)
20
12.20 BLAST Query:DNAProtein Database:DNAProtein blastn – nucleotides vs. nucleotides blastp– protein vs. protein blastx – translated query vs. protein database tblastn– protein vs. translated nuc. DB tblastx– translated query vs. translated database You can search using BLAST proteins or DNA:
21
12.21 First we need to have the BLAST results in a text file BioPerl can read. Here is one way to achieve this (using NCBI BLAST):NCBI BLAST BioPerl: reading BLAST output Text Download An alternative is to use BLASTALL on your computerBLASTALL
22
12.22 Query= gi|52840257|ref|YP_094056.1| chromosomal replication initiator protein DnaA [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (452 letters) Database: Coxiella.faa 1818 sequences; 516,956 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|29653365|ref|NP_819057.1| chromosomal replication initiator p... 633 0.0 gi|29655022|ref|NP_820714.1| DnaA-related protein [Coxiella burn... 72 4e-14 gi|29654861|ref|NP_820553.1| Holliday junction DNA helicase B [C... 32 0.033 gi|29654871|ref|NP_820563.1| ATPase, AFG1 family [Coxiella burne... 27 1.4 gi|29654481|ref|NP_820173.1| hypothetical protein CBU_1178 [Coxi... 25 3.1 gi|29654004|ref|NP_819696.1| succinyl-diaminopimelate desuccinyl... 25 3.1 BioPerl: reading BLAST output Query Results info
23
12.23 gi|215919162|ref|NP_820316.2| threonyl-tRNA synthetase [Coxiella... 25 5.3 gi|29655364|ref|NP_821056.1| transcription termination factor rh... 24 9.0 gi|215919324|ref|NP_821004.2| adenosylhomocysteinase [Coxiella b... 24 9.0 gi|29653813|ref|NP_819505.1| putative phosphoribosyl transferase... 24 9.0 >gi|29653365|ref|NP_819057.1| chromosomal replication initiator protein [Coxiella burnetii RSA 493] Length = 451 Score = 633 bits (1632), Expect = 0.0 Identities = 316/452 (69%), Positives = 371/452 (82%), Gaps = 5/452 (1%) Query: 1 MSTTAWQKCLGLLQDEFSAQQFNTWLRPLQAYMDEQR-LILLAPNRFVVDWVRKHFFSRI 59 + T+ W KCLG L+DE QQ+NTW+RPL A +Q L+LLAPNRFV+DW+ + F +RI Sbjct: 3 LPTSLWDKCLGYLRDEIPPQQYNTWIRPLHAIESKQNGLLLLAPNRFVLDWINERFLNRI 62 Query: 60 EELIKQFSGDDIKAISIEVGSKPVEAVDTPAETIVTSSSTAPLKSAPKKAVDYKSSHLNK 119 EL+ + S D I +++GS+ E + + AP + + +++N Sbjct: 63 TELLDELS-DTPPQIRLQIGSRSTEMPTKNSHEPSHRKAAAPPAGT---TISHTQANINS 118 Query: 120 KFVFDSFVEGNSNQLARAASMQVAERPGDAYNPLFIYGGVGLGKTHLMHAIGNSILKNNP 179 F FDSFVEG SNQLARAA+ QVAE PG AYNPLFIYGGVGLGKTHLMHA+GN+IL+ + Sbjct: 119 NFTFDSFVEGKSNQLARAAATQVAENPGQAYNPLFIYGGVGLGKTHLMHAVGNAILRKDS 178 BioPerl: reading BLAST output Result header high scoring pair (HSP) data HSP Alignment Note: There could be more than one HSP for each result, in case of homology in different parts of the protein
24
12.24 The Bio::SearchIO module can read and parse BLAST output: use Bio::SearchIO; my $blast_report = Bio::SearchIO->new("-file" => "<LegCox.blastp", "-format" => "blast"); my ($resultObj, $hitObj, $hspObj); while( defined($resultObj = $blast_report-> next_result() ) ){ print "Checking query ".$resultObj-> query_name()."\n"; while( defined($hitObj = $resultObj-> next_hit ()) ) { print "Checking hit ". $hitObj-> name ()."\n"; $hspObj = $hitObj-> next_hsp (); print "Best score: ".$hspObj ->score ()."\n"; } } (See the BLAST output example in course web-site) Bio::SearchIO : reading BLAST output
25
12.25 You can send parameters to the subroutines of the objects: # Get length of HSP (including gaps) $hspObj -> length("total") ; # Get length of hit part of alignment (without gaps) $hspObj -> length("hit") ; # Get length of query part of alignment (without gaps) $hspObj -> length("query") ; More about what you can do with query, hit and hsp see in: http://www.bioperl.org/wiki/HOWTO:SearchIO#Table_of_Methods BioPerl: reading BLAST output
26
13.26 Class exercise 13b 1.Uses Bio::SearchIO to parse the BLAST results: (LegCox.blastp provided in the course web-site) a)For each query print out its name and the name of its first hit. b*)Print the % identity of each HSP of the first hit of each query. c*)Print the e-value of each HSP of the first hit of each query.
27
12.27 Installing BioPerl – how to add a repository to the PPM Start All Programs Active Perl… Perl Package manager You might need to add a repository to the PPM before installing BioPerl:
28
12.28 Installing modules from the internet The best place to search for Perl modules that can make your life easier is: http://www.cpan.org/ http://www.cpan.org/ The easiest way to download and install a module is to use the Perl Package Manager (part of the ActivePerl installation) Note: ppm installs the packages under the directory “site\lib\” in the ActivePerl directory. You can put packages there manually if you would like to download them yourself from the net, instead of using ppm. 1.Choose “ View all packages ” 2. Enter module name (e.g. bioperl) 3. Choose module (e.g. bioperl) 5. Install! 4. Add it to the installation list
29
12.29 Installing BioPerl – how to add a repository to the PPM Click the “Repositories” tab, enter “bioperl” in the “Name” field and http://bioperl.org/DIST in the “Location” field, click “Add”, and finally “OK”:
30
12.30 BioPerl installation In order to add BioPerl packages you need to download and execute the bioperl10.bat file from the course website. If that that does not work – follow the instruction in the last three slides of the BioPerl presentation. Reminder: BioPerl warnings about: Subroutine... redefined at... Should not trouble you, it is a known issue – it is not your fault and won't effect your script's performances.
31
12.31 Installing modules from the internet Alternatively in older Active Perl versions- Note: ppm installs the packages under the directory “site\lib\” in the ActivePerl directory. You can put packages there manually if you would like to download them yourself from the net, instead of using ppm.
Similar presentations
© 2025 SlidePlayer.com. Inc.
All rights reserved.