Presentation is loading. Please wait.

Presentation is loading. Please wait.

Glycopeptide MS/MS Spectra Supplemental Data 2. gi|310722811Vacuolar invertase 1 [Gossypium hirsutum] R.LFLFNNASGVNVK.A + Deamidated (NQ)1423.8701 01.

Published byImogen Norton Modified over 9 years ago

Similar presentations

Presentation on theme: "Glycopeptide MS/MS Spectra Supplemental Data 2. gi|310722811Vacuolar invertase 1 [Gossypium hirsutum] R.LFLFNNASGVNVK.A + Deamidated (NQ)1423.8701 01."— Presentation transcript:

1 Glycopeptide MS/MS Spectra Supplemental Data 2

2 gi|310722811Vacuolar invertase 1 [Gossypium hirsutum] R.LFLFNNASGVNVK.A + Deamidated (NQ)1423.8701 01 Supplemental Data 2

3 K.ITGSIPAGLTDLELQFMNVSYNR.L + Deamidated (NQ) 1423.8701 gi|33469564Polygalacturonase-inhibiting protein [Gossypium barbadense]02 Supplemental Data 2

4 K.TVDQYYFGGNNSIR.G + Deamidated (NQ)1634.8681 gi|224065294Predicted protein [Populus trichocarpa]03 Supplemental Data 2

5 K.KDENMAGEWNYTSGK.W + Deamidated (NQ); Oxidation (M)1746.8402 gi|147834599Hypothetical protein VITISV_010536 [Vitis vinifera] Calreticulin 04 Supplemental Data 2

6 R.TLANSNLPGFNNTLDR.L + Deamidated (NQ)1747.8700 gi|19569160Apoplastic anionic gaiacol peroxidase [Gossypium hirsutum]05 Supplemental Data 2

7 R.TNLTASGPRPNPQGSYHY.G + Deamidated (NQ)1960.8028 gi|16648889Unknown protein [Arabidopsis thaliana] Pectinesterase 06 Supplemental Data 2

8 R.DELDFEFLGNR.T + Deamidated (NQ)1355.5002 gi|2244732Endo-xyloglucan transferase [Gossypium hirsutum]07 Supplemental Data 2

9 R.QYAGYVTVNESHGR.A + Deamidated (NQ)1581.6491 gi|102139937Serine carboxypeptidase (carboxypeptidase D), putative [Musa acuminata] 08 Supplemental Data 2

10 K.AAESWVHDNVTR.Y + Deamidated (NQ)1385.7208 gi|296085019Unnamed protein product [Vitis vinifera] Glucan endo-1,3-beta-glucosidase 9-like 09 Supplemental Data 2

11 R.VPTVNVSVVDLTVR.L + Deamidated (NQ)1498.7457 gi|311690856Putative glyceraldehyde 3-phosphate dehydrogenase [Ophrys sphegodes] 10 Supplemental Data 2

12 R.MLLNDANSTGEKK.T + Deamidated (NQ); Oxidation (M)1437.5909 gi|34395384Putative tetratricopeptide repeat(TPR)-containing protein [Oryza sativa Japonica Group] 11 Supplemental Data 2

13 R.WNVSASGAR.P + Deamidated (NQ)948.4052 gi|110739787Pollen-specific protein [Arabidopsis thaliana]12 Supplemental Data 2

14 R.WNVSASGARPNPQGSFR.Y + Deamidated (NQ) 1831.9080 gi|357476949Monocopper oxidase-like protein SKU5 [Medicago truncatula] 13 Supplemental Data 2

15 K.FPGPTINSTTNNNVVINVR.N + Deamidated (NQ) 2057.887 Cotton_D_gene_10024265Predicted protein [Populus trichocarpa] Monocopper oxidase-like protein SKU5 14

16 R.SANGNITPYLGNR.T + Deamidated (NQ) 1377.6601 gi|133902314Putative protein disulfide isomerase [Gossypium hirsutum] 15 Supplemental Data 2

17 R.DEIGNISSSHLR.T + Deamidated (NQ) 1328.6318 gi|118488320Unknown [Populus trichocarpa] PREDICTED: Dolichyl-diphosphooligosaccharide- -protein glycosyltransferase subunit 1 16 Supplemental Data 2

18 R.VPVGPTSGRTNDSAWR.A + Deamidated (NQ) 1700.8705 gi|42409419Hypothetical protein [Oryza sativa Japonica Group] 17 Supplemental Data 2

19 T.AEGNQVNVTTGVVNATVENSVFSDR.R + 2 Deamidated (NQ) 2609.4349 gi|157273646Fasciclin-like arabinogalactan protein 6 [Gossypium hirsutum] 18 Supplemental Data 2

20 A.YDPLDPNGNVTIK.W + Deamidated (NQ) 1446.8152 gi|255636649Unknown [Glycine max] COBRA-like protein 4-like19 Supplemental Data 2

21 T.YNGTNHLIK.K + Deamidated (NQ) 1060.6245 gi|15223517 Calreticulin-1 [Arabidopsis thaliana] 20 Supplemental Data 2

22 K.CNGTKDSISK.L + Deamidated (NQ) 1110.4172 gi|116787210Unknown [Picea sitchensis] Triosephosphate isomerase 21 Supplemental Data 2

23 Q.YGIDKDFSNESR.H + Deamidated (NQ) 1431.7726 gi|326523407Predicted protein [Hordeum vulgare subsp. vulgare] Hypoxia up-regulated protein 1-like 22 Supplemental Data 2

24 Y.TFTAAELSNR.T + Deamidated (NQ) 1110.5915 Cotton_D_gene_10038147Predicted protein [Populus trichocarpa] Dessication related protein 23

25 Supplemental Data 2 R.GVDEALNETVCVLDDCR.G + Deamidated (NQ)+ Carbamidomethylation 1965.7318 Cotton_D_gene_10008412Lysosomal alpha mannosidase24

26 Supplemental Data 2 K.ATVDGQNISFLEAAR.S + Deamidated (NQ) 1592.6866 Cotton_D_gene_10002405N-Carbamoyl-L-amino acid hydrolase-like [Vitis vinifera] 25

27 Supplemental Data 2 R.YHAHQYTNGTQCDLTNQPR.E + Deamidated (NQ)+ Carbamidomethylation 2304.8245 Cotton_D_gene_10022550Conserved hypothetical protein [Ricinus communis] 26

28 Supplemental Data 2 K.TPVNISDAAHVR.K + Deamidated (NQ) 1280.624 Cotton_D_gene_10005734Predicted :glucosidase 2 subunit beta like [Vitis vinifera] 27

29 Supplemental Data 2 K.YNSTLSILR.L + Deamidated (NQ) 1067.5916 Cotton_D_gene_10001623Epidermis specific secreted glycoprotein EP1-like [Gossypium hirsutum] 28

30 Supplemental Data 2 K.GGKFPLNVT.A+ Deamidated (NQ) 933.5058 Cotton_D_gene_10004214Fasciclin like arabinogalactan protein 6 [Gossypium hirsutum] 29

31 Supplemental Data 2 K.EANVSGVPVVR.L+ Deamidated (NQ) 1127.566 Cotton_D_gene_10032854Radial Swelling 3, glucosidase/hydrolase [Arabidopsis thaliana] 30

32 Supplemental Data 2 K.NVTQHITSNNVNIR.Y+ Deamidated (NQ) 1610.7202 Cotton_D_gene_10016755Predicted: hypothetical protein [Vitis vinifera] glucan endo-1,3-beta-glucosidase 8 31

33 Supplemental Data 2 K.VLNLSSNQLSGDLPSSLR.S+ Deamidated (NQ) 1900.8851 Cotton_D_gene_10007821Probable inactive receptor kinase [Vitis vinifera]32

34 Supplemental Data 2 R.NNSLTGALPPLLVTSPR.L+ Deamidated (NQ) 1750.9243 Cotton_D_gene_10007821Probable inactive receptor kinase [Vitis vinifera]32

35 Supplemental Data 2 K.STQVANQLLGQLNNSNNGMTVFAPTDNAFSSLK.S + Deamidated (NQ) 3482.7322 gi|30841338Arabinogalactan protein [Gossypium hirsutum]33

36 Supplemental Data 2 R.TQAGDSGDGKFPLNITTSGN.S + Deamidated (NQ) 1980.9635 gi|30841338Arabinogalactan protein [Gossypium hirsutum]33

37 Supplemental Data 2 K.KPSLSNLTNDQLK.S + Deamidated (NQ) 1458.8081 gi|157273638Fasciclin-like arabinogalactan protein 2 [Gossypium hirsutum]34

38 Supplemental Data 2 K.VLDTFQNQANNTDQGITIFVPK.D + Deamidated (NQ) 2464.2792 gi|157273638Fasciclin-like arabinogalactan protein 2 [Gossypium hirsutum]34

39 Supplemental Data 2 K.ALTKPSLSNLTDDQFK.S + Deamidated (NQ) 1778.9685 gi|606942Unknown [Gossypium hirsutum] Fascilin Like Arabinogalactan protein 3 35

40 Supplemental Data 2 Q.IQANNTVEGITIFVPK.D + Deamidated (NQ) 1744.9679 gi|606942Unknown [Gossypium hirsutum] Fascilin Like Arabinogalactan protein 3 35

41 Supplemental Data 2 K.GDSMNLTIPEPGPTTIR.N + Deamidated (NQ); Oxidation (M) 1815.9306 gi|70927645Endo-alpha-1,4-glucanase [Gossypium hirsutum]36

42 Supplemental Data 2 K.SNNFSCAIVVVGEHPYVETK.G + Deamidated (NQ) 2251.1009 gi|70927645Endo-alpha-1,4-glucanase [Gossypium hirsutum]36

43 Supplemental Data 2 R.ITYPPHANYTY.S + Deamidated (NQ) 1340.6237 gi|70927645Endo-alpha-1,4-glucanase [Gossypium hirsutum]36

44 Supplemental Data 2 K.VDNITSILEK.G + Deamidated (NQ) 1132.6194 gi|157273646 Fasciclin-like arabinogalactan protein 6 [Gossypium hirsutum] 37

45 Supplemental Data 2 K.FPLNVTAEGNQVNVTTGVVNATVENSVFSDR.R + 3 Deamidated (NQ) 3281.3277 gi|157273646 Fasciclin-like arabinogalactan protein 6 [Gossypium hirsutum] 37

46 Supplemental Data 2 K.TVTVNDFVYSGLAATGNTSNLIK.A + Deamidated (NQ) 2386.2452 gi|119657105 GLP3 [Gossypium barbadense] 38

47 Supplemental Data 2 R.EYQNTGPGANTSSR.V + Deamidated (NQ) 1482.6579 gi|377824751 Pectin methylesterase [Gossypium hirsutum] 39

48 Supplemental Data 2 K.GYSVITNISEAQTYTAR.N + Deamidated (NQ) 1874.9058 gi|377824751 Pectin methylesterase [Gossypium hirsutum] 39

49 Supplemental Data 2 R.DVVPLNVTR.H + Deamidated (NQ) 1013.5810 gi|319433443 Copper binding protein 4 [Gossypium hirsutum] 40

50 Supplemental Data 2 K.TDYESCNADHPLHNWTTGAGR.D + Deamidated (NQ) 2403.0439 gi|319433443 Copper binding protein 4 [Gossypium hirsutum] 40

51 Supplemental Data 2 R.SVLYDNK.T + Deamidated (NQ) 839.4473 gi|310722811 vacuolar invertase 1 [Gossypium hirsutum] 41

52 Supplemental Data 2 R.LFLFNNASGVNVK.A + Deamidated (NQ) 1423.7399 gi|310722811 vacuolar invertase 1 [Gossypium hirsutum] 41

53 Supplemental Data 2 R.ACCGGGGPYNFNISAR.C + Deamidated (NQ) 1701.7330 gi|356555408 PREDICTED: GDSL esterase/lipase At5g45910-like [Glycine max] 42

54 Supplemental Data 2 K.YYYEVGIGNSSR.R + Deamidated (NQ) 1408.6678 gi|357601486 PAP1 [Gossypium hirsutum] 43

55 Supplemental Data 2 K.YFNYTSGFIH.H + Deamidated (NQ) 1249.5434 gi|357601486 PAP1 [Gossypium hirsutum] 43

56 Supplemental Data 2 R.TQAGDSGDGEFPLNVTTSGNTVVLK.T + Deamidated (NQ) 2508.2466 gi|150416577 Arabinogalactan protein 4 [Gossypium hirsutum] 44

57 Supplemental Data 2 K.VFNASGLR.K + Deamidated (NQ) 864.4829 gi|356565586 PREDICTED: PI-PLC X domain-containing protein At5g67130-like [Glycine max] 45

58 Supplemental Data 2 R.EASYGHSTLEIKNR.T + Deamidated (NQ) 1605.8077 gi|21464654 Acid phosphatase [Lupinus luteus] 46

59 Supplemental Data 2 R.HLPNLNGTIQPAIAK.L + Deamidated (NQ) 1587.8790 gi|33469564 Polygalacturonase-inhibiting protein [Gossypium barbadense] 47

60 Supplemental Data 2 K.CHLNVSNTR.D + Deamidated (NQ) 1101.5469 gi|118485725 Unknown [Populus trichocarpa] 48

61 Supplemental Data 2 K.METSVINGTYR.G + Deamidated (NQ); Oxidation (M) 1287.6395 gi|224071567 Predicted protein [Populus trichocarpa] 49

62 Supplemental Data 2 R.DGGNVSDITFSNINISTR.Y + 2 Deamidated (NQ) 1911.9479 gi|224137954 Predicted protein [Populus trichocarpa] 50

63 Supplemental Data 2 Q.TVQLYTDQTGANISR.N + Deamidated (NQ) 1667.8728 gi|116784836 Unknown [Picea sitchensis] 51

64 Supplemental Data 2 S.IKSNGEAIGAWNYTNAESFIR.F + Deamidated (NQ)2342.1635 gi|30692673 Heparanase-like protein 3 [Arabidopsis thaliana] 52

65 Supplemental Data 2 D.SFPPSQAFFNR.S + Deamidated (NQ)1298.6176 gi|224065148 Predicted protein [Populus trichocarpa] Glucan endo-1,3-beta-glucosidase 53

66 Supplemental Data 2 R.TQAGQDFGLNVTGLNNQVNVSSGVVETQINNALYQK.K + Deamidated (NQ) 3822.697 gi|150416583 fasciclin-like arabinogalactan protein 1 [Gossypium hirsutum] 54

67 Supplemental Data 2 R.TQAGQDFGLNVTGLNNQVNVSSGVVETQINNALYQK.K + Deamidated (NQ) 3823.6704 gi|150416583 fasciclin-like arabinogalactan protein 1 [Gossypium hirsutum] 54

68 Supplemental Data 2 1564.7441 gi|102139937 Serine carboxypeptidase, putative [Musa acuminata] 55 R.QYAGYVTVNESHGR.A+ Deamidated (NQ)

69 Supplemental Data 2 R.FFTESSGATLLNATLQK.D + Deamidated (NQ) 1828.9166 Cotton_D_gene_10033394 Alpha N-arabinofuranosidase 56

70 Supplemental Data 2 R.FFTESSGATLLNATLQK.D + Deamidated (NQ) 2471.1626 Cotton_D_gene_10014527 Predicted protein [Populus trichocarpa] Reticuline oxidase precursor 57

71 Supplemental Data 2 R.YNVSSGER.Y + Deamidated (NQ)912.3548 Cotton_D_gene_10016522 Purple acid phosphatase 58

72 Supplemental Data 2 R.EASYGHSTLEIQNR.T + Deamidated (NQ) 1605.8077 Cotton_D_gene_10016522 Purple acid phosphatase 58

73 Supplemental Data 2 K.IGPGISNITTIDEAER.I + Deamidated (NQ) 1686.8928 Cotton_D_gene_10006598 Protein disulfide isomerase 59

74 Supplemental Data 2 K.AEVAAAIKNETR.I + Deamidated (NQ)1273.6945 Cotton_D_gene_10018695 Peroxidase 1 [Litchi chinensis] 60

75 Supplemental Data 2 R.SHIYNDSNIDPSFANSLR.R + Deamidated (NQ) 2051.0088 Cotton_D_gene_10018695 Peroxidase 1 [Litchi chinensis] 60

76 Supplemental Data 2 R.SGNDSVLAPLDR.Q + Deamidated (NQ)1244.6280 Cotton_D_gene_10018695 Peroxidase 1 [Litchi chinensis] 60

77 Supplemental Data 2 R.VNDFIAAALAQANVTR.T + Deamidated (NQ) 1674.8328 Cotton_D_gene_10026954 Predicted protein [Populus trichocarpa] alpha-mannosidase 61

78 Supplemental Data 2 R.ASLNLTILK.K + Deamidated (NQ)973.6125 Cotton_D_gene_10003411 Unknown [Populus trichocarpa] GPI anchored glycoprotein membrane precursor 62

79 Supplemental Data 2 K.NQPCTNSTGANTVPGTEPQFANYPN LLAK.C + Deamidated (NQ) 3105.4327 Cotton_D_gene_10003411 Unknown [Populus trichocarpa] GPI anchored glycoprotein membrane precursor 62

80 Supplemental Data 2 N.DVINSTVQPYTFTAAELSNR.T + Deamidated (NQ) 2228.0731 Cotton_D_gene_10038147 Predicted protein [Populus trichocarpa] Dessication related protein 63

81 Supplemental Data 2 K.AEGLIVPLQLGAENR.T + Deamidated (NQ) 1580.7849 Cotton_D_gene_10038147 Predicted protein [Populus trichocarpa] Dessication related protein 63

82 Supplemental Data 2 S.MVFGTGNATMPGGLFPR.G + Deamidated (NQ) 1785.8795 Cotton_D_gene_10038147 Predicted protein [Populus trichocarpa] Dessication related protein 63

83 Supplemental Data 2 R.VNDFVAAAIAQANITR.T+ Deamidated (NQ) 1674.8120 Cotton_D_gene_1008412 Lysosomal alpha-mannosidase 64

84 Supplemental Data 2 K.VIDTFQNQANNTDQGITVFVPK.D + Deamidated (NQ) 2450.2419 Cotton_D_gene_10023812 Fasciclin –like arabinogalactan protein 2 [Gossypium hirsutum] 65

85 Supplemental Data 2 K.GEFNGSSISVLSR.N+ Deamidated (NQ)1353.6686 Cotton_D_gene_10025549 Disease resistance responsive family [Arabidopsis thaliana] 66

86 Supplemental Data 2 K.VTDNPADELVAALNANR.T+ Deamidated (NQ) 1783.8048 Cotton_D_gene_10037278 Conserved hypothetical protein [Ricinus communis] 67

87 Supplemental Data 2 K.AGLLNESAIDK.A+ Deamidated (NQ)1131.6030 Cotton_D_gene_10029587 Beta-xylosidase [Vitis vinifera] 68

88 Supplemental Data 2 R.TQAGDSGDGKFPLNVTTSGN.S+ Deamidated (NQ) 1966.9382 Cotton_D_gene_10015846 Arabinogalactan protein 2 [Gossypium hirsutum] 69

89 Supplemental Data 2 C.NLYNDPNTLASFNVTVPEALR.I+ Deamidated (NQ) 2349.1935 Cotton_D_gene_10009564 Lipid binding protein, putative [Ricinus communis] 70

90 Supplemental Data 2 N.LLTNSSANGTSPTADCCNSLK.T+ Deamidated (NQ) 2213.0205 Cotton_D_gene_10005290 Lipid binding protein, putative [Ricinus communis] 71

91 Supplemental Data 2 K.TVQLYTDQTGANISR.S+ Deamidated (NQ) 1667.8728 Cotton_D_gene_10030668 Exordium like protein [Arabidopsis thaliana] 72

92 Supplemental Data 2 G.GSAVGAWNYTNAESFIR.Y+ Deamidated (NQ) 1843.6965 Cotton_D_gene_10016528 Predicted: heparanase-like protein 3-like [Vitis vinefera] 73

93 Supplemental Data 2 G.GSAVGAWNYTNAESFIR.Y+ Deamidated (NQ) 1578.8358 Cotton_D_gene_10039675 Apoplastic anionic gaiacol peroxidase [Gossypium hirsutum] 74

Download ppt "Glycopeptide MS/MS Spectra Supplemental Data 2. gi|310722811Vacuolar invertase 1 [Gossypium hirsutum] R.LFLFNNASGVNVK.A + Deamidated (NQ)1423.8701 01."

Similar presentations

Conserved gene order in Basidiomycetes An investigation of synteny within and between: Laccaria bicolor Coprinopsis cinerea Phanerochaete chrysosporium.

Conserved gene order in Basidiomycetes An investigation of synteny within and between: Laccaria bicolor Coprinopsis cinerea Phanerochaete chrysosporium.
Mechanism of hormone action

Mechanism of hormone action
44 D (3 Khipu elements) 14 12 Phaseolus vulgaris B4 locus 410 Kb contig 158 kb Sub- cluster C 400 Kb 300 Kb 250 Kb 200 Kb 150 Kb 100 Kb 50 Kb 28 21 15.

44 D (3 Khipu elements) Phaseolus vulgaris B4 locus 410 Kb contig 158 kb Sub- cluster C 400 Kb 300 Kb 250 Kb 200 Kb 150 Kb 100 Kb 50 Kb
Class I-A Class II-A Class II-B Class II- Basal Class I-B Class I Class II 0.1 Arabidopsis thaliana PHO1;H2 Capsella rubella PHO1;H11 100 Thellungiella.

Class I-A Class II-A Class II-B Class II- Basal Class I-B Class I Class II 0.1 Arabidopsis thaliana PHO1;H2 Capsella rubella PHO1;H Thellungiella.
Scarlet Runner Bean Genome Annotation: Contig 257429.

Scarlet Runner Bean Genome Annotation: Contig
1 Eukaryotic Secretome Prediction and Knowledge-Base Development Xiang-Jia “Jack” Min Ph.D., Assistant Professor 2 nd International Conferences on Proteomics.

1 Eukaryotic Secretome Prediction and Knowledge-Base Development Xiang-Jia “Jack” Min Ph.D., Assistant Professor 2 nd International Conferences on Proteomics.
The Scarlet Runner Bean Genome: Contig 230613 By Eden Maloney.

The Scarlet Runner Bean Genome: Contig By Eden Maloney.
Protein Structure Investigating DFR specificity in anthocyanin biosynthesis Fazeeda Hosein Sarasvati BahadurSingh Nigel Jalsa Cecilia Diaz David Gopaulchan.

Protein Structure Investigating DFR specificity in anthocyanin biosynthesis Fazeeda Hosein Sarasvati BahadurSingh Nigel Jalsa Cecilia Diaz David Gopaulchan.
2D-PAGE MS/MS Spectra Supplemental Data 1. Spot ID : GP 01 K.HYTAYDVDNWK.G 1411.661 gi|292630922Beta-xylosidase/alpha-L-arabinofuranosidase [Medicago.

2D-PAGE MS/MS Spectra Supplemental Data 1. Spot ID : GP 01 K.HYTAYDVDNWK.G gi| Beta-xylosidase/alpha-L-arabinofuranosidase [Medicago.
AP Bio: Chp.11 Cell Communication. G-protein-linked receptors: vary in their binding sites and for recognizing different G-proteins. Most have seven alpha.

AP Bio: Chp.11 Cell Communication. G-protein-linked receptors: vary in their binding sites and for recognizing different G-proteins. Most have seven alpha.
Alfalfa (Medicago sativa). Sericea Lespedeza (Lespedeza cuneata)

Alfalfa (Medicago sativa). Sericea Lespedeza (Lespedeza cuneata)
ANALYSE DE L’EXPRESSION DE GÈNES STADE-SPÉCIFIQUES CHEZ LE PARASITE PROTOZOAIRE LEISHMANIA Barbara Papadopoulou, Ph.D. François McNicoll, Maxime Laverdière,

ANALYSE DE L’EXPRESSION DE GÈNES STADE-SPÉCIFIQUES CHEZ LE PARASITE PROTOZOAIRE LEISHMANIA Barbara Papadopoulou, Ph.D. François McNicoll, Maxime Laverdière,
Scarlet Runner Bean Genome Assembly Nancy Phang June 4, 2004.

Scarlet Runner Bean Genome Assembly Nancy Phang June 4, 2004.
Essentials of Glycobiology Lecture 29 May 18, 2004 Plant Glycans Marilynn Etzler Section of Molecular and Cellular Biology University of California Davis,

Essentials of Glycobiology Lecture 29 May 18, 2004 Plant Glycans Marilynn Etzler Section of Molecular and Cellular Biology University of California Davis,
Unfected > Infected AnnotationAccession numberGOName and other namesRDiscussed CDC45-related proteinCU986535 apoptosis/cell cycle Cdc45l, Cdc451.11x Centrosomal.

Unfected > Infected AnnotationAccession numberGOName and other namesRDiscussed CDC45-related proteinCU apoptosis/cell cycle Cdc45l, Cdc451.11x Centrosomal.
Figure S1: Sequence of the mtr-miR159b backbone for amiRNA expression in pBluescriptII SK+ vector. AmiRNA constructs are generated from this template using.

Figure S1: Sequence of the mtr-miR159b backbone for amiRNA expression in pBluescriptII SK+ vector. AmiRNA constructs are generated from this template using.
WT L2 L3 L4 L5 L6 L15 L21 L23 L2 L5 L7 L8 BnSTM BrSTM BoSTM AtUBQ10 B A Supplementary Fig. 1 C 0 1 2 3 4 WT L2 L3 L4 0 2 4 6 WTL2L5L7L8 0 1 2 3 4 WTL5L6L15L21.

WT L2 L3 L4 L5 L6 L15 L21 L23 L2 L5 L7 L8 BnSTM BrSTM BoSTM AtUBQ10 B A Supplementary Fig. 1 C WT L2 L3 L WTL2L5L7L WTL5L6L15L21.
1 Chapter 3: Protein ZHOU Yong Department of Biology Xinjiang Medical University.

1 Chapter 3: Protein ZHOU Yong Department of Biology Xinjiang Medical University.
AC CNR ACCNR 15 DPA B+7 A: 35 members E: 19 members B: 21 members C: 10 members D: 138 members F: 20 members G: 109 members H: 87 members I: 20 members.

AC CNR ACCNR 15 DPA B+7 A: 35 members E: 19 members B: 21 members C: 10 members D: 138 members F: 20 members G: 109 members H: 87 members I: 20 members.
Tel1: TcChr9-PGroup I HP*HP RNA pol IIIHP 8kb 1 Telomeric RepeatRHS* RHSBRCA2N-Acetiyltransferase*RNA helicase*ASF-1ATPaseSIRETS*TSVIPER/SIREL1TcVIPER/SIRERHS*DGF-1Phosphate.

Tel1: TcChr9-PGroup I HP*HP RNA pol IIIHP 8kb 1 Telomeric RepeatRHS* RHSBRCA2N-Acetiyltransferase*RNA helicase*ASF-1ATPaseSIRETS*TSVIPER/SIREL1TcVIPER/SIRERHS*DGF-1Phosphate.

Similar presentations

Ads by Google