Presentation is loading. Please wait.

Presentation is loading. Please wait.

Figure S1 AtFTComFT2HGtFT1GtFT2 A. thaliana ( 29 dpi ) PsFTa1GtFT1InFT1 H PsFTa1 GtFT1 InFT1 H GtFT2 Tobacco ‘Xanthi nc’ (55 dpi) (86 dpi) (108 dpi) Figure.

Published byRose Jefferson Modified over 8 years ago

Similar presentations

Presentation on theme: "Figure S1 AtFTComFT2HGtFT1GtFT2 A. thaliana ( 29 dpi ) PsFTa1GtFT1InFT1 H PsFTa1 GtFT1 InFT1 H GtFT2 Tobacco ‘Xanthi nc’ (55 dpi) (86 dpi) (108 dpi) Figure."— Presentation transcript:

1 Figure S1 AtFTComFT2HGtFT1GtFT2 A. thaliana ( 29 dpi ) PsFTa1GtFT1InFT1 H PsFTa1 GtFT1 InFT1 H GtFT2 Tobacco ‘Xanthi nc’ (55 dpi) (86 dpi) (108 dpi) Figure S1 Promotion of flowering in A. thaliana and tobacco plants infected with the ALSV vector expressing FT orthologue genes presented in Table S1 Photographs were taken at 29 dpi in A. thaliana and 55 dpi, 86 dpi, and 108 dpi in tobacco.

2 Figure S2 123567911171920212223A1A2A3 Non-infected H2OH2O PC Sample No. MdTFL1 AtFT No. A1No. 9 (A) (B) Figure S2 (A) RT-PCR analysis of apple seedlings infected with ALSV-AtFT/MdTFL1 at 6 mpi MdTFL1 was detected in all 17 samples, but AtFT was not detected in 7 samples No. 2, 3, 6, 9, 11, 19, or 21, indicating that MdTFL1 was stably maintained, while AtFT was deleted in 40% of samples. (B) Apple seedlings infected with ALSV- AtFT/MdTFL1. Sample No. 9, which lost AtFT, shows vegetative growth of the shoot (11 mpi). In contrast, sample No. A1 shows continuous flowering (7.5 mpi).

3 * AtFT MSINIRDPLIVSRVVGDVLDPFNRSITLKVTYGQREVTNGLDLRPSQVQNKPRVEIGGED MdFT1 MPRD-RDPLVVGRVVGDVLDPFTRSVSLRVTYGTKEVNNGCELKPSEVVQQPRADIGGDD MdFT2 MPRD-RDPLVVGRVVGDVLDPFTRSVSLRVTYGNKEVNNGCELKPSQVVHQPRVDTGGDD.................................... AtFT LRNFYTLVMVDPDVPSPSNPHLREYLHWLVTDIPATTGTTFGNEIVCYENPSPTAGIHRV MdFT1 LRTFYTLVMVDPDAPSPSDPNLKEYLHWLVTDIPATTAASFGQEIVCYESPRPTVGIHRF MdFT2 LRTFYTLVMVDPDAPSPSDPNLKEYLHWLVTDIPATTAASFGQEIVCYESPRPTVGIHRF............................................. AtFT VFILFRQLGRQTVYAPGWRQNFNTREFAEIYNLGLPVAAVFYNCQRESGCGGRRL MdFT1 VLVVFRQLGRQTVYAPGWRQNFNTRDFAELYNLGLPVSVVYFNCQREGGSGGRRR MdFT2 VFVLFRQLGRQTVYAPGWRQNFNTRDFAELYNLGLPVAAVYFNCQRESGSGGRRR...................................... 160 61 121 120 175 Segment B Figure S3 Figure S3 Multiple alignment of the amino acid sequences of AtFT (A.thaliana, AAF03936), MdFT1 (apple, ACL98164), and MdFT2 (apple, BAD08340). The segment B and Y85 which are important for FT function were written in red and yellow, respectively. Blue denotes missesnse mutations of ft allels in Arabidopsis (Ahn et al. EMBO J. 25, 605-614, 2006; Taoka et al. Trends in Plant Sci 18, 287-294, 2013). Dot denotes residues in that column are identical in all sequences of the alignment. Analysis was performed by a software DNAsis pro (Hitachi, Japan).

Download ppt "Figure S1 AtFTComFT2HGtFT1GtFT2 A. thaliana ( 29 dpi ) PsFTa1GtFT1InFT1 H PsFTa1 GtFT1 InFT1 H GtFT2 Tobacco ‘Xanthi nc’ (55 dpi) (86 dpi) (108 dpi) Figure."

Similar presentations

Fig. S1 A622 1 MVVSEKSKILIIGGTGYIGKYLVETSAKSGHPTFALIRESTLKNPEKSKLIDTFKSYGVT 60 A622L 1..................................V.......V................. 60 A622.

Fig. S1 A622 1 MVVSEKSKILIIGGTGYIGKYLVETSAKSGHPTFALIRESTLKNPEKSKLIDTFKSYGVT 60 A622L V V A622.
Supplemental Fig. S1 Ihsan et al., 2015 Supplemental Fig. S1 Sequence analysis of Solanaceous MAGO NASHI genes. ClustalW multiple alignments of nucleotide.

Supplemental Fig. S1 Ihsan et al., 2015 Supplemental Fig. S1 Sequence analysis of Solanaceous MAGO NASHI genes. ClustalW multiple alignments of nucleotide.
Suplemental Data Figure S1. Alignment of deduced amino acid sequence of CaGA2ox1 and other GA2ox homologs from the pepper EST database. Dark shading indicates.

Suplemental Data Figure S1. Alignment of deduced amino acid sequence of CaGA2ox1 and other GA2ox homologs from the pepper EST database. Dark shading indicates.
DAD1L1L2L3L4L5DGL 0 9 Relative mRNA levels 3 2 1 A DAD1L1L2L3L4L5DGL 0 6 Relative mRNA levels 3 2 1 B Wounded Untreated MeJA Mock 4 5 8 7 6 5 4 Plant Cell.

DAD1L1L2L3L4L5DGL 0 9 Relative mRNA levels A DAD1L1L2L3L4L5DGL 0 6 Relative mRNA levels B Wounded Untreated MeJA Mock Plant Cell.
I Ia II Ib I IaIb IIIII IV V VI Figure S1. Comparison of amino acid sequence of O. sativa (Os) SUV3 (1-579) with SUV3 from A. thaliana (At) (1-571), H.

I Ia II Ib I IaIb IIIII IV V VI Figure S1. Comparison of amino acid sequence of O. sativa (Os) SUV3 (1-579) with SUV3 from A. thaliana (At) (1-571), H.
HKT1 form Arabidopsis relative extremophile Thellungiella work as Na/K co-transporter.

HKT1 form Arabidopsis relative extremophile Thellungiella work as Na/K co-transporter.
Dim ‐ 2 encodes a DNA methyltransferase responsible for all known cytosine methylation in Neurospora by Elena Kouzminova, and Eric U. Selker EMBO J. Volume.

Dim ‐ 2 encodes a DNA methyltransferase responsible for all known cytosine methylation in Neurospora by Elena Kouzminova, and Eric U. Selker EMBO J. Volume.
Relative expression levels

Relative expression levels
Positive Negative Tanz et al. Supp Fig. 1 unassigned st r . . & env.

Positive Negative Tanz et al. Supp Fig. 1 unassigned st r . . & env.
Figure S1. Sequence alignment of Arabidopsis NodGS with other plant and fungal orthologues. Abbreviations are as follows: Populus trichocarpa (Ptr), Ricinus.

Figure S1. Sequence alignment of Arabidopsis NodGS with other plant and fungal orthologues. Abbreviations are as follows: Populus trichocarpa (Ptr), Ricinus.
Fig. 1. NS1 protein alignment and linear epitope mapping of the 10 antibodies used to run the DENV serotype–specific NS1 rapid tests, pan-DENV NS1 test,

Fig. 1. NS1 protein alignment and linear epitope mapping of the 10 antibodies used to run the DENV serotype–specific NS1 rapid tests, pan-DENV NS1 test,
The Role of Recently Derived FT Paralogs in Sunflower Domestication

The Role of Recently Derived FT Paralogs in Sunflower Domestication
Amino‐acid sequence of the heterogeneous nuclear RNP G protein family and RNA‐binding SELEX consensus sequence obtained for human RBMY. (A) Sequence alignment.

Amino‐acid sequence of the heterogeneous nuclear RNP G protein family and RNA‐binding SELEX consensus sequence obtained for human RBMY. (A) Sequence alignment.
Most promoters preserve their relative activity levels across conditions. Most promoters preserve their relative activity levels across conditions. (A)

Most promoters preserve their relative activity levels across conditions. Most promoters preserve their relative activity levels across conditions. (A)
Expression levels from the HIS3 gene and growth during histidine starvation are optimised by the natural HIS3 codon usage in yeast Start codon clearance.

Expression levels from the HIS3 gene and growth during histidine starvation are optimised by the natural HIS3 codon usage in yeast Start codon clearance.
Heatmaps of the gene mutation distributions in oncogene‐signaling blocks for six representative cancer types. Heatmaps of the gene mutation distributions.

Heatmaps of the gene mutation distributions in oncogene‐signaling blocks for six representative cancer types. Heatmaps of the gene mutation distributions.
Multiple sequence alignment of the BAR domains from Amphiphysins and from the subset of BAR domain family members that were shown to bind to a small GTPase.

Multiple sequence alignment of the BAR domains from Amphiphysins and from the subset of BAR domain family members that were shown to bind to a small GTPase.
Zhu Hui-Fen , Fitzsimmons Karen , Khandelwal Abha , Kranz Robert G.  

Zhu Hui-Fen , Fitzsimmons Karen , Khandelwal Abha , Kranz Robert G.  
Supplemental Figure S1. Alignment of drimenol synthase amino acid sequences from P. hydropiper and V. officinalis. Amino acid sequences were aligned with.

Supplemental Figure S1. Alignment of drimenol synthase amino acid sequences from P. hydropiper and V. officinalis. Amino acid sequences were aligned with.
Multiple sequence alignment and analysis of SOFL proteins.

Multiple sequence alignment and analysis of SOFL proteins.

Similar presentations

Ads by Google