Presentation is loading. Please wait.

Presentation is loading. Please wait.

Bioinformatics – NSF Summer School 2003 Z. Luthey-Schulten, UIUC.

Published byEmery Walker Modified over 9 years ago

Similar presentations

Presentation on theme: "Bioinformatics – NSF Summer School 2003 Z. Luthey-Schulten, UIUC."— Presentation transcript:

1 Bioinformatics – NSF Summer School 2003 Z. Luthey-Schulten, UIUC

2 Sequence-Sequence Alignment Smith-Watermann Needleman-Wunsch Sequence-Structure Alignment Threading Hidden Markov

3 Sequence Alignment & Dynamic Programming Seq. 1: a 1 a 2 a 3 - - a 4 a 5 …a n Seq. 2: c 1 - c 2 c 3 c 4 c 5 - …c m number of possible alignments: Smith-Waterman alignment algorithm Score Matrix H: Traceback AWGHE AW--HE

4 AWGHE AW--HE Smith-Waterman Local Alignment Score Matrix

5 Blosum 40 Substitution Matrix

6 Protein Structural Relationships Can protein structural relationships help us to understand evolutionary dynamics? Is there a connection between evolutionary events and changes in protein structure? What is the effect of gene duplication, horizontal gene transfer, and other evolutionary mechanisms on protein shape? SubstitutionIndelDomain Insertion O’Donoghue and Luthey-Schulten, UIUC 2003

7 Sequence Alignment & Dynamic Programming Seq. 1: a 1 a 2 a 3 - - a 4 a 5 …a n Seq. 2: c 1 - c 2 c 3 c 4 c 5 - …c m number of possible alignments: Needleman-Wunsch alignment algorithm Score Matrix H: Traceback ??? Tutorial: W=d

8 Needleman-Wunsch Global Alignment Similarity Values Initialization of Gap Penalties http://www.dkfz-heidelberg.de/tbi/bioinfo/PracticalSection/AliApplet/index.html

9 Filling out the Score Matrix H http://www.dkfz-heidelberg.de/tbi/bioinfo/PracticalSection/AliApplet/index.html

10 Traceback and Alignment The Alignment Traceback (blue) from optimal score http://www.dkfz-heidelberg.de/tbi/bioinfo/PracticalSection/AliApplet/index.html

11 Energy Landscape Theory of Structure Prediction

12 Protein Structure Prediction SISSIRVKSKRIQLG…. 1-D protein sequence3-D protein structure Sequence Alignment Ab Initio protein folding SISSRVKSKRIQLGLNQAELAQKV------GTTQ… QFANEFKVRRIKLGYTQTNVGEALAAVHGS… Target protein of unknown structure Homologous/analogous protein of known structure Sequence Alignment: the Energy Function ? E= E match + E gap E gap = E match =

13 A1A1 A3A3 A2A2 A4A4 A 5 … “Scaffold” structure Target sequence threading alignment between target and scaffold Threading: Sequence-Structure Alignment Threading Energy Function R. Goldstein, Z. Luthey-Schulten, P. Wolynes (1992, PNAS)

14 Gap Penalties Sequence-Structure Gap Energy Distribution of Gaps InsertionDeletion target scaffold Bulge R. Goldstein, Z. Luthey-Schulten, P. Wolynes (1994) Proc 27 th Annu Hawaii Int Conf Sys Sci:306.

15 Similarity Measures Sequence Identity fraction of identically matched residues Q “Structural Identity” fraction of native contacts

16 EsEs 22

17 Homology Modeling - Threading

18 Results from CASP5 CM/FR The prediction is never better than the scaffold. Threading Energy function requires improvement.

19 You are now entering the twilight zone of sequence identity. We need profiles! Watch for Bioinformants!!!

20 Profiles – Evolution Revisited “What molecular sequences taught us in the 1960’s was that the genealogical history of an organism is written to one extent or another into the sequences of each of its genes, an insight that became the central tenet of a new discipline, molecular evolution” Woese (PNAS, 2000) Pauling (1965)

21 Universal Tree The Universal Phylogenetic Tree inferred from comparative analyses of rRNA sequences: Woese(PNAS, 1990)

22 Horizontal Gene Transfer O’Donoghue and Luthey-Schulten, UIUC 2003

23 Multiple Sequence Alignments “The aminoacyl-tRNA synthetases, perhaps better than any other molecules in the cell, eptiomize the current situation and help to under standard (the effects) of HGT” Woese (PNAS, 2000; MMBR 2000)

24 Standard Dogma Molecular Biology DNA RNA Proteins Role of AARS? Charging of t-RNA

25 NCBI 3D

26 LeuRS Canonical Tree Woese, Olsen (UIUC), Ibba (Panum Inst.), Soll (Yale) Micro. Mol. Biol. Rev. March 2000..

27 D,N Sequence Phylogenetic Trees Woese, Olsen (UIUC), Ibba (Panum Inst.), Soll (Yale) Micro. Mol. Biol. Rev. March 2000..

28 Fold Motifs of AARSs O’Donoghue and Luthey-Schulten, UIUC 2003

29 Structure Conserved More than Sequence Structural Overlap of Class II AARS Conserved helicesConserved sheets

30 Subset of Class II Structural Tree O’Donoghue and Luthey-Schulten, UIUC 2003

31

32 Novel Evolutionary Connections from Sequence and Structure Woese, Olsen (UIUC), Ibba (Panum Inst.), Soll (Yale) Micro. Mol. Biol. Rev. March 2000.. Canonical Pattern D E F L W Y BAE Canonical Pattern + A B I H P M Basal Canonical V T A R B A Gemini K 1 K 2 C S G N Q No canonical pattern Horizontal transfer after B-AE split. O’Donoghue, Luthey-Schulten, UIUC 2003

33 l, gap length (residues)r ij, spatial gap distance (Å) Gap Distribution Functions Spatial Gap Distribution FuncitonLength Gap Distribution Function B. Qian & R. Goldstein. (2001) Proteins 45:102.

34 Structural Alignment Methods PDB - Structural Neighbors – CE (Bourne) Stamp - Russell

35 Multiple Structural Alignments STAMP 1.Initial Alignment Multiple Sequence alignment Ridged Body “Scan” 2.Refine Initial Alignment & Produce Multiple Structural Alignment R. Russell, G. Barton (1992) Proteins 14: 309. Dynamic Programming (Smith-Waterman) through P matrix gives optimal set of equivalent residues. This set is used to re-superpose the two chains. Then iterate until alignment score is unchanged. This procedure is performed for all pairs.

36 Multiple Structural Alignments STAMP – cont’d 2.Refine Initial Alignment & Produce Multiple Structural Alignment Alignment score: Multiple Alignment: Create a dendrogram using the alignment score. Successively align groups of proteins (from branch tips to root). When 2 or more sequences are in a group, then average coordinates are used.

37 Stamp Output/Secondary Structure O’Donoghue and Luthey-Schulten, UIUC 2003

38 Stamp Output/Clustal Format O’Donoghue and Luthey-Schulten, UIUC 2003

39 Examples of Useful Web Tools Genomes – Sequence and Gene Information Domain Architecture Multiple Sequence Alignments Phylogenetic Trees Structural Databases Hidden Markov Methods

40 NCBI: Genomes

41 Charging the tRNA Woese, Olsen (UIUC), Ibba (Panum Inst.), Soll (Yale) Micro. Mol. Biol. Rev. March 2000..

42 NCBI 3D

43 Report from SWISS-PROT

44 PFAM Report

45

46 Sequence Dendrogram from Clustal Luthey-Schulten, UIUC 2003

47 Phylogenetic Tree in Tutorial Pogorelov and Luthey-Schulten, UIUC 2003

48

49 Alignment in MOE

50

51 Transmembrane Proteins - HMM Example Bacteriorhodpsin – Anurag Sethi UIUC

52 Stamp Profile Sethi and Luthey-Schulten, UIUC 2003

53

54 HMMer Profile-Profile Alignment Sethi and Luthey-Schulten, UIUC 2003

55 Clustal Profile-Profile Alignment Sethi and Luthey-Schulten, 2003

56 Structure Prediction Modeller 6.2/Hmmer Sethi and Luthey-Schulten, UIUC 2003 Modeller 6.2 A. Sali, et al.

57 Acknowledgements Felix Autenrieth Barry Isralewitz Patrick O’Donoghue Taras Pogorelov Anurag Sethi

Download ppt "Bioinformatics – NSF Summer School 2003 Z. Luthey-Schulten, UIUC."

Similar presentations

1 Introduction to Sequence Analysis Utah State University – Spring 2012 STAT 5570: Statistical Bioinformatics Notes 6.1.

1 Introduction to Sequence Analysis Utah State University – Spring 2012 STAT 5570: Statistical Bioinformatics Notes 6.1.
Alignment methods Introduction to global and local sequence alignment methods Global : Needleman-Wunch Local : Smith-Waterman Database Search BLAST FASTA.

Alignment methods Introduction to global and local sequence alignment methods Global : Needleman-Wunch Local : Smith-Waterman Database Search BLAST FASTA.
Sequence allignement 1 Chitta Baral. Sequences and Sequence allignment Two main kind of sequences –Sequence of base pairs in DNA molecules (A+T+C+G)*

Sequence allignement 1 Chitta Baral. Sequences and Sequence allignment Two main kind of sequences –Sequence of base pairs in DNA molecules (A+T+C+G)*
Profile Hidden Markov Models Bioinformatics Fall-2004 Dr Webb Miller and Dr Claude Depamphilis Dhiraj Joshi Department of Computer Science and Engineering.

Profile Hidden Markov Models Bioinformatics Fall-2004 Dr Webb Miller and Dr Claude Depamphilis Dhiraj Joshi Department of Computer Science and Engineering.
Profiles for Sequences

Profiles for Sequences
C E N T R F O R I N T E G R A T I V E B I O I N F O R M A T I C S V U E 02-11-2006 Alignments 1 Sequence Analysis.

C E N T R F O R I N T E G R A T I V E B I O I N F O R M A T I C S V U E Alignments 1 Sequence Analysis.
Structural bioinformatics

Structural bioinformatics
Introduction to Bioinformatics Burkhard Morgenstern Institute of Microbiology and Genetics Department of Bioinformatics Goldschmidtstr. 1 Göttingen, March.

Introduction to Bioinformatics Burkhard Morgenstern Institute of Microbiology and Genetics Department of Bioinformatics Goldschmidtstr. 1 Göttingen, March.
Sequence Similarity Searching 75321 Class 4 March 2010.

Sequence Similarity Searching Class 4 March 2010.
Non-coding RNA William Liu CS374: Algorithms in Biology November 23, 2004.

Non-coding RNA William Liu CS374: Algorithms in Biology November 23, 2004.
HIDDEN MARKOV MODELS IN MULTIPLE ALIGNMENT. 2 HMM Architecture Markov Chains What is a Hidden Markov Model(HMM)? Components of HMM Problems of HMMs.

HIDDEN MARKOV MODELS IN MULTIPLE ALIGNMENT. 2 HMM Architecture Markov Chains What is a Hidden Markov Model(HMM)? Components of HMM Problems of HMMs.
1-month Practical Course Genome Analysis (Integrative Bioinformatics & Genomics) Lecture 3: Pair-wise alignment Centre for Integrative Bioinformatics VU.

1-month Practical Course Genome Analysis (Integrative Bioinformatics & Genomics) Lecture 3: Pair-wise alignment Centre for Integrative Bioinformatics VU.
Bioinformatics and Phylogenetic Analysis

Bioinformatics and Phylogenetic Analysis
What you should know by now Concepts: Pairwise alignment Global, semi-global and local alignment Dynamic programming Sequence similarity (Sum-of-Pairs)

What you should know by now Concepts: Pairwise alignment Global, semi-global and local alignment Dynamic programming Sequence similarity (Sum-of-Pairs)
. Protein Structure Prediction [Based on Structural Bioinformatics, section VII]

. Protein Structure Prediction [Based on Structural Bioinformatics, section VII]
Tutorial 2: Some problems in bioinformatics 1. Alignment pairs of sequences Database searching for sequences Multiple sequence alignment Protein classification.

Tutorial 2: Some problems in bioinformatics 1. Alignment pairs of sequences Database searching for sequences Multiple sequence alignment Protein classification.
Multiple sequence alignment

Multiple sequence alignment
Pairwise Alignment Global & local alignment Anders Gorm Pedersen Molecular Evolution Group Center for Biological Sequence Analysis.

Pairwise Alignment Global & local alignment Anders Gorm Pedersen Molecular Evolution Group Center for Biological Sequence Analysis.
Protein Structure and Function Prediction. Predicting 3D Structure –Comparative modeling (homology) –Fold recognition (threading) Outstanding difficult.

Protein Structure and Function Prediction. Predicting 3D Structure –Comparative modeling (homology) –Fold recognition (threading) Outstanding difficult.
Project No. 7 Structural Genomics of the RGS Protein Family: Development of a Public Web-based Informatics Database Resource Dahai Gai Samuel Kalet Hongbo.

Project No. 7 Structural Genomics of the RGS Protein Family: Development of a Public Web-based Informatics Database Resource Dahai Gai Samuel Kalet Hongbo.

Similar presentations

Ads by Google