1. Informatics for Molecular Biologists Ansuman Chattopadhyay,PhD Head, Molecular Biology Information Service Falk Library, Health Sciences Library System University of Pittsburgh

2. Molecular Biology Information Service Falk Library of Health Sciences Health Sciences Library System University of Pittsburgh 200 Scaife Hall Desoto and Terrace Streets Pittsburgh, PA 15261

3. Topics Searching tools –Internet –PubMed NCBI developed bioinformatics tools –Entrez Gene Structure visualization tools –Cn3D Genome Browsers –UCSC genome browsers –NCBI Map viewer

4. Information search space Biomedical literature databases Molecular databases Organism whole genome sequences

5. Literature database NCBI PubMed –contains over 15 million citations dating back to the mid-1950's.mid-1950's Search: “apoptosis”: 130,476 “breast cancer”: 160,055 “p53”: 42,418

6. Molecular databases

8. Organisms whole genome sequences http://www.genomesonline.org/

9. Internet for Biologists Google Vs Clusty –Google: Chronological list of search results –Clusty: Search results categorized into topical clusters Vivísimo's clustering technology creates topical categories on-the-fly from the search results, using terms in the title, snippet, and any other available textual description in the search results themselves

10. Google Vs Clusty Search Example: Pittsburgh –GoogleGoogle –ClustyClusty

11. Clusters help you see your search results by topic, so you can zero in on exactly what you’re looking for or discover unexpected relationships between items.

12. Search examples for Clusty SNP BLAST Lupus

13. Web 2.0 Website bookmark and tagging tool –Del.icio.us a social bookmarking web service for storing, sharing, and discovering web bookmarks.

14. Web 2.0 Connotea; http://www.connotea.org/Connotea

15. Medline searching tool PubMed vs ClusterMedPubMed Search example : macular degeneration, cell cycle, p53

16. Molecular databases DNA Sequence Databases and Analysis Tools Enzymes and Pathways Gene Mutations, Genetic Variations and Diseases Genomics Databases and Analysis Tools Immunological Databases and Tools Microarray, SAGE, and other Gene Expression Organelle Databases Other Databases and Tools (Literature Mining, Lab Protocols, Medical Topics, and others) Plant Databases Protein Sequence Databases and Analysis Tools Proteomics Resources RNA Databases and Analysis Tools Structure Databases and Analysis Tools

17. HSLS OBRC http://www.hsls.pitt.edu/guides/genetics/obrc/

18. Types of databases –By level of curation: Archival –GenBank, GenPept, ssSNP Curated –Refseq, SwissProt, RefSNP

19. Types of databases –Archival data repository of information redundant; might have many sequence records for the same gene, each from a different lab submitters maintain editorial control over their records: what goes in is what comes out no controlled vocabulary variation in annotation of biological features Example: GenBank record

20. GenBank archival database of nucleotide sequences from >130,000 organisms records annotated with coding region (CDS) features also include amino acid translations each record represents the work of a single lab redundant; can have many sequence records for a single gene

21. International Nucleotide Sequence Database Collaboration

23. Types of databases

24. Refseq Curated data –non-redundant; one record for each gene, or each splice variant –each record is intended to present an encapsulation of the current understanding of a gene or protein, similar to a review article –records contain value-added information that have been added by an expert(s)

25. Refseq Database of reference sequences Curated Non-redundant; one record for each gene, or each splice variant, from each organism represented A representative GenBank record is used as the source for a RefSeq record Value-added information is added by an expert(s) Each record is intended to present an encapsulation of the current understanding of a gene or protein, similar to a review article Variety of accession number prefixes (NM_, NP_, etc.) and status codes (provisional, reviewed, etc.). More about those in later slides. RefSeq database includes genomic DNA, mRNA, and protein sequences, so organizes information according to the model of the central dogma of biology

26. RefSeq

27. Searching GenBank Find messenger RNA sequence for Human epidermal growth factor (EGF) gene.

28. Databases developers NCBI EBI

30. Neighbors and Hard Links Genomes Taxonomy PubMed abstracts Nucleotide sequences Protein sequences 3-D Structure Word weight VAST BLAST Phylogeny Source NCBI

31. NCBI Tools

33. Entrez Gene NCBI’s database for gene centric information focuses on organisms genome completely sequenced an active research community to contribute gene-specific information scheduled for intense sequence analysis –Total Taxa: 4246; Total Genes: 284,3587 160,000 organisms in the nucleotide sequence database (Genbank)

34. Entrez gene each record represents a single gene from a given organism Gene record includes: –a unique identifier or GeneID assigned by NCBI –a preferred symbol –and any one or more of: –sequence information –map information –official nomenclature from an authority list –alternate gene symbols –summary of gene/protein function –published references that provide additional information on function –expression –homology data –and more

35. SNP Genomic Sequence Exon-Intron Structure Expression Profile Interacting Partners 3D Structure mRNA Sequence Chromosomal Localization Disease Amino acid Sequence Homologous Sequences Gene / Protein

36. Searching Entrez Gene

37. Entrez gene Find: gene symbols and aliases sequences: genomic, mRNA, protein intron-exon architecture genomic context: neighboring and antisense genes Interacting partners associated gene ontology terms: function, cellular component and biological process

38. Entrez Gene record Query: BRCA1 Search Tips:  Query text box: BRCA1  Limits: To limit your search to a specific field, select: “Gene name” from drop-down menu Limit by taxonomy: select “Homo sapiens” Name and aliases Chromosoma l location

39. Sourse: NCBI

40. Entrez Gene: sequences and genomic context Sequences: mRNA, Genomic, Protein mRNA Seq ProteinSeq Genomic Seq

41. Transcription and alternative splicing Alternative splicing: http://www.exonhit.com/UserFiles/Image/epissage.swf?PHPSESSID=d9u8tiu2sioqa8u29bkop3l0l2 http://www.exonhit.com/UserFiles/Image/epissage.swf?PHPSESSID=d9u8tiu2sioqa8u29bkop3l0l2

42. Entrez Gene: intron-exon architectures Tips: Change Display to “Gene Table” from “Summary”

43. Genomic SeqmRNA Seq ProteinSeq

44. Gene Ontology –Controlled vocabulary tagging Function Biological Processes Cellular Component

45. Entrez Gene : Gene Ontology

46. Homologous sequences

47. Entrez Gene: Homologous sequence Tips: change Display settings from" summary” to “Alignment score” to “Multiple Alignment”

48. Single nucleotide polymorphisms Single nucleotide polymorphisms (SNP) are DNA sequence variations that occur when a single nucleotide (A,T,C,or G) in the genome sequence is altered. For example a SNP might change the DNA sequence AAGGCTAA to ATGGCTAA

49. SNPs

50. Coding SNPs

51. Entrez Gene: SNPs

52. Protein Info: HPRD

54. Entrez Gene: Links

55. Entrez Gene: Linkout

56. Seq to Entrez gene: UCSC BLAT Query Seq: SGLTPEEFMLVYKFARKHHITLTNLITEE

57. BLAT to Entreze Gene CLICK

58. Find chromosomal location of your gene of interest. How many exons have been reported for your gene? What are its neighboring genes ? Query sequence: IHYNYMCNSSCMGGMNRRPILTII Hands-On Exercise Question

59. Exercise: Find the protein sequence for rat leptin. BLAT this sequence vs. the human genome to find the human homolog. Look for SNPs in the coding region of this gene—are there any?

60. Sequence alignment Pair wise alignment Multiple alignment

61. Pairwise alignment Global –Needleman Wunsc (1970) Local –Smith-Waterman (1981) –Lipman and Pearson /FASTA (1985) –Basic Local Alignment Search Tool (BLAST:1991)

62. BLAST To find homologous sequence for a sequence of interest by searching sequence databases: Nucleotide: Protein: TTGGATTATTTGGGGATAATAATGAAGATAGCAA TTATCTCAGGGAAAGGAGGAGTAGGAAAATCTTC TA TTTCAACATCCTTAGCTAAGCTGTTTTCAAAAG AGTTTAATATTGTAGCATTAGATTGTGATGTTGAT MSVMYKKILYPTDFSETAEIALKHVKAFKTLKAEEVILLHVIDER EIKKRDIFSLLLGVAGLNKSVEEFE NELKNKLTEEAKNKMENIK KELEDVGFKVKDIIVVGIPHEEIVKIAEDEGVDIIIMGSHGKTNLKEILLG

63. BLAST To Find statistically significant matches, based on sequence similarity, to a protein or nucleotide sequence of interest. Obtain information on inferred function of the gene or protein. Find conserved domains in your sequence of interest that are common to many sequences. Compare two known sequences for similarity.

64. What you can do with BLAST Find homologous sequence in all combinations (DNA/Protein) of query and database. –DNA Vs DNA –DNA translation Vs Protein –Protein Vs Protein –Protein Vs DNA translation –DNA translation Vs DNA translation

65. BLAST exercise Find homologous sequences for uncharacterized archaebacterial protein, NP_247556, from Methanococcus jannaschii

66. BLAST search Sort by E values 2X10 -65 Sequence description Link to Entrez number of display cut off (100)over rides E value cut off (10) Descriptions of hits

67. BLAST search Orthologs from closely related species will have the highest scores and lowest E values –Often E = 10 -30 to 10 -100 Closely related homologs with highly conserved function and structure will have high scores –Often E = 10 -15 to 10 -50 Distantly related homologs may be hard to identify –Less than E = 10 -4

68. Protein domains Wikipedia SH2Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr). SH2 domains typically bind pTyr-containing ligands via two surface pockets, a pTyr and hydrophobic binding pocket, allowing proteins with SH2 domains to localize to tyrosine phosphorylated sites.

69. Searching CDD CDD SEARCH Query sequence:

70. Blink BLink displays the graphical output of pre-computed blastp results against the protein non-redundant (nr) database. This graphical output includes: –Alignment of up to 200 BLAST hits on the query sequence –Best Hits to each organism –List of known protein domains in the query sequence –Filter hits by selecting the BLAST cutoff score –Distribution of hits by taxonomic grouping –Display of similar sequences with known 3D structure –Filter hits by database and/or by taxonomic grouping –Display a taxonomic tree of all organisms with similar sequences Access : Link out from NCBI protein records Link toTP53 Blink: http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?val=NP_000537.2&dopt=gp http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?val=NP_000537.2&dopt=gp

71. Protein structure

72. Protein data bank (PDB) international database of 3-D biological macromolecular structures accepts direct submissions of structure data maintained by a nonprofit organization, the Research Collaboratory for Structural Bioinformatics (RCSB), associated with Rutgers University, San Diego Supercomputer Center, and the Biotechnology Division of the National Institute of Standards and Technology contains molecular structures of proteins and nucleic acids, primarily structures experimentally-derived by X-Ray crystallography and NMR also includes some theoretical models, though they are not encouraged.

73. 3D structure viewing software NCBI Cn3D First glance in Jmol A simple tool for macromolecular visualization. The Cn3D home page includes a link in the blue sidebar for instructionsCn3D home page on installing Cn3D, which is available for PC, Mac, and Unix.installing Cn3D

74. Cn3D View the 3-dimensional structure for 1TUP and practice using some of the Cn3D features that allow you to: –spin the structure using your mouse –use the control+left mouse button combination to zoom in and out of the structure –use the shift+left mouse button combination to move the structure across the viewing window –use the Style menu to render the structure in different ways (e.g., worms, space fill, ball and stick,...) –use the Style menu to color the structure in different ways (e.g., secondary structure, domain,...) –use the Style/Edit Global Style to label every 20th amino acids

75. What is it? Genome Browser is a computer program which helps to display gene maps, browse the chromosomes, align genes or gene models with ESTs or contigs etc.

76. Genome Sequence Project Time Line 1976 : RNA Bacteriophage MS2 1995: Haemophilus influenzae 2003: Human genome reference sequence 2005: 265 genomes; 21 archaeal, 211 bacterial, 33 eukaryotic

77. http://www.genomesonline.org/

79. Genome Browsers NCBI MAP Viewer EBI Ensembl UCSC Genome Browser