Download presentation
Presentation is loading. Please wait.
1
Eukaryotic mRNA processing
Exon Intron Exon Intron Exon DNA Cap Transcription Addition of cap and tail RNA transcript with cap and tail Introns removed Tail Exons spliced together mRNA Coding sequence Nucleus Cytoplasm Eukaryotic mRNA processing Alternative splicing Cap and Tail
2
Alternative Splicing of Exons
Can result in related proteins This version has all exons included: mmnvnavyakcvtpdeavtlitsgshlsgmfaaeppallnalakrakr* These versions have different exons included in the final verison of the protein mmnvnavyakcvtpdgmfaaeppallnalakrakr* eavtlitsgshlsgmfaaeppallnalakrakr*
3
Alternative splicing makes it possible for a single gene to code for a number of different variations of a protein. Splicing patterns can be tissue-specific, so that a certain variation of a protein is produced in a specific tissue.
4
Gene Mutations Which is most harmful? Which is least harmful?
Normal gene mRNA Base substitution Base deletion Missing Met Lys Phe Gly Ala Ser Leu His A U G C Protein Gene Mutations Which is most harmful? Which is least harmful? What would happen if a base was inserted?
Similar presentations
© 2025 SlidePlayer.com. Inc.
All rights reserved.