Presentation is loading. Please wait.

Presentation is loading. Please wait.

Supplementary Fig. 1. (A) PCR amplification of wheat TaHSP26 genomic, cDNA and ORF clones. (B) ORF and protein sequence of TaHSP26. An arrowhead indicates.

Published byLiliana Lucas Modified over 8 years ago

Similar presentations

Presentation on theme: "Supplementary Fig. 1. (A) PCR amplification of wheat TaHSP26 genomic, cDNA and ORF clones. (B) ORF and protein sequence of TaHSP26. An arrowhead indicates."— Presentation transcript:

1 Supplementary Fig. 1. (A) PCR amplification of wheat TaHSP26 genomic, cDNA and ORF clones. (B) ORF and protein sequence of TaHSP26. An arrowhead indicates the putative processing site. Nucleotide sequence in dark blue box represents chloroplast transit peptide (AA 1-44) and conserved α-crystallin domain (ACD) (136-230), respectively, and sequence in red box show conserved amphipathic α-helix. 5’ 3’ A B cDNAGenomic M ORF 1Kb 750bp

2 Supplementary Fig. 2. Phylogenetic analysis of chloroplastic HSP26. The tree was constructed using CLUSTALX by Neighborhood joining method, with the respective bootstrap values. Ta-g (Triticum aestivum g allele, AAC 96315.1)At (Arabidopsis thaliana, NP_194497.1) Ta-e (Triticum aestivum e allele, AAC 96314.1)Rc (Ricinus communis, XP_002532054.1) Ta-m (Triticum aestivum m allele, AAC 96317.1)Ps (Pisum sativum, CAA30167.1) Ta-i (Triticum aestivum i allele, AAC 96316.1)Nt (Nicotiana tabacum, BAA29065.1) Tm (Triticum monococcum, CAI 96517.1)Ga (Gossypium arboreum, ABI97958.1) Td (Triticum dicoccum, CAI 96514.1)Pp (Physcometrilla patens, XP_001767809.1) Tdu (Triticum durum, CAI 96515.1)Fh (Fumaria hygrometrica, AAF19021.1) Hv (Hordeum vulgare, AAB 28590.1)Sm (Selaginella moellendorffii, XP_002963639.1) As (Agrostis stolonifera, AAN 74538.1)Zm (Zea mays, NP_001105583.1) Sb (Sorghum bicolor, XP_002468181.1)Os (Oryza sativa, NP_001049541.1) Vv (Vitis vinifera, XP_002272418.1)Pt (Populus trichocarpa, XP_002318460.1) Gm (Glycine max, CAA30168.0)Cr (Chlamydomonas reinhardtii, XP_001701015.1)

3 BLAST against DNA/protein collections mapped in, or associated with, plant genomes (PLANTBLAST) NCBI/ MapViewerNCBIMapViewer Supplementary Fig. 3. Location of chloroplastic TaHSP26 on wheat homologous chromosomes. A B

4 Supplementary Fig. 4. Analysis of different T 3 homozygous Arabidopsis transgenic lines over-expressing chloroplastic TaHSP26. RT-PCR of NPTII gene (A), andTaHSP26 gene (B) and Western analysis with anti TaHSP26 antibodies (C). WT 3.1 3.2 5.1 5.3 6.2 6.3 6.4 7.1 7.3 A B C

5 Supplementary Fig. 5. Induction of AtHSP26 gene in various antisense lines. (A) Semi- quantitative RT-PCR and (B) Western analysis after 2h heat stress at 39 o C. WT-C WT-HS AS2 AS6 AS10 AS11 AS12 AS13 AS14 AS15 AS16 AS18 At HSP26 At actin 1 WT-HS AS2 AS6 AS10 AS11 AS12 AS13 AS14 AS16 AS18 A B At HSP26

6 M L1 L 2 L3 L4 L5 3000bp 1000bp A 3000bp M L1 L 2 L3 L4 L5 B 3000bp 1000bp D Supplementary Fig. 6. Cloning of putative promoter of Ta HSP26 through directional genome walking. L1-L5 represents different adapter ligated genomic libraries. (A) Result of first walking, a ~1200 bp fragment was cloned and sequenced.(B) Result of second walking, a ~1500 bp fragment was cloned and sequenced. (C) Nucleotide BLAST result of combined sequence of first and second genome walking (2718 bp). (D) Final putative promoter of TaHSP26-G of1514 bp length. C Wheat HSP26 cDNA Wheat Actin gene

7 10’ 20’ 50’ 24 h C 10’ 20’ 30’ 40’ 50’ 60’ 2h 24h Promoter activity after heat stress Relative fold change Heat stress A B Supplementary Fig.7. Induction of GUS gene governed by TaHSP26, P26 promoter in transgenic Arabidopsis plants at different time points of heat stress. (A & B) quantitative RT-PCR and semi-quantitative RT-PCR for GUS transcript, and GUS histochemical assay (C). C

8 Supplementary Fig. 8. Analysis of P26 promoter of TaHSP26 activity in different tissues of transgenic Arabidopsis plants after a 2 h heat stress treatment at 37 o C. (A) Control inflorescence, (B) GUS accumulation in inflorescence at various stages, (C-D) GUS in a mature flower and petals and (E-F) in pollen. (G) wild type silique, (H&I) mature silique from transgenic plants, (J) developing seeds and mature seeds from transgenic plants (K & L). A B C D E F G H I J K L

Download ppt "Supplementary Fig. 1. (A) PCR amplification of wheat TaHSP26 genomic, cDNA and ORF clones. (B) ORF and protein sequence of TaHSP26. An arrowhead indicates."

Similar presentations

Problem Results: Question: 1. You screen two libraries- cDNA; genomic

Problem Results: Question: 1. You screen two libraries- cDNA; genomic
Class I-A Class II-A Class II-B Class II- Basal Class I-B Class I Class II 0.1 Arabidopsis thaliana PHO1;H2 Capsella rubella PHO1;H11 100 Thellungiella.

Class I-A Class II-A Class II-B Class II- Basal Class I-B Class I Class II 0.1 Arabidopsis thaliana PHO1;H2 Capsella rubella PHO1;H Thellungiella.
Isolation and Functional Characterization of genes related to Kernel Development by Differential Hybridization and Yeast Two Hybrid Screening in extra-early.

Isolation and Functional Characterization of genes related to Kernel Development by Differential Hybridization and Yeast Two Hybrid Screening in extra-early.
The MYB and BHLH Transcription Factor Families by Elaine Chiu.

The MYB and BHLH Transcription Factor Families by Elaine Chiu.
Chloroplast DNA in Molecular Systematics. -organelle found in plant cells and eukaryotic algae -Photosynthesis Chloroplast.

Chloroplast DNA in Molecular Systematics. -organelle found in plant cells and eukaryotic algae -Photosynthesis Chloroplast.
Fig. S1 A622 1 MVVSEKSKILIIGGTGYIGKYLVETSAKSGHPTFALIRESTLKNPEKSKLIDTFKSYGVT 60 A622L 1..................................V.......V................. 60 A622.

Fig. S1 A622 1 MVVSEKSKILIIGGTGYIGKYLVETSAKSGHPTFALIRESTLKNPEKSKLIDTFKSYGVT 60 A622L V V A622.
Suppl. Fig. S1 Suppl. Fig. S1 The nucleotide sequence and its deduced amino acid sequences of CaSAMDC. The full-length of CaSAMDC (GenBank Accession No.

Suppl. Fig. S1 Suppl. Fig. S1 The nucleotide sequence and its deduced amino acid sequences of CaSAMDC. The full-length of CaSAMDC (GenBank Accession No.
Figure S1: Sequence of the mtr-miR159b backbone for amiRNA expression in pBluescriptII SK+ vector. AmiRNA constructs are generated from this template using.

Figure S1: Sequence of the mtr-miR159b backbone for amiRNA expression in pBluescriptII SK+ vector. AmiRNA constructs are generated from this template using.
Supplemental Fig. S1 Ihsan et al., 2015 Supplemental Fig. S1 Sequence analysis of Solanaceous MAGO NASHI genes. ClustalW multiple alignments of nucleotide.

Supplemental Fig. S1 Ihsan et al., 2015 Supplemental Fig. S1 Sequence analysis of Solanaceous MAGO NASHI genes. ClustalW multiple alignments of nucleotide.
WT L2 L3 L4 L5 L6 L15 L21 L23 L2 L5 L7 L8 BnSTM BrSTM BoSTM AtUBQ10 B A Supplementary Fig. 1 C 0 1 2 3 4 WT L2 L3 L4 0 2 4 6 WTL2L5L7L8 0 1 2 3 4 WTL5L6L15L21.

WT L2 L3 L4 L5 L6 L15 L21 L23 L2 L5 L7 L8 BnSTM BrSTM BoSTM AtUBQ10 B A Supplementary Fig. 1 C WT L2 L3 L WTL2L5L7L WTL5L6L15L21.
Figure S1. Genomic PCR of in vitro potato plants transformed with StPTB1 prom (top) and StPTB6 prom (bottom) constructs using nptII-specific primers. Thirty.

Figure S1. Genomic PCR of in vitro potato plants transformed with StPTB1 prom (top) and StPTB6 prom (bottom) constructs using nptII-specific primers. Thirty.
HC70AL Final Presentation Chris McQuilkin June 4 th, 2009.

HC70AL Final Presentation Chris McQuilkin June 4 th, 2009.
Supplemental Figure 1S. Alignment and phylogeny of CRY proteins. Comparison of the amino acid sequences of the DNA-photolyase domain (a) and FAD binding.

Supplemental Figure 1S. Alignment and phylogeny of CRY proteins. Comparison of the amino acid sequences of the DNA-photolyase domain (a) and FAD binding.
Figure S1. Effects of AVG, DIECA, DPI, NMMA, STA, and OKA on IbRPK expression in sweet potato (Ipomoea batatas cv. Tainung 57). Leaves with petiole cuts.

Figure S1. Effects of AVG, DIECA, DPI, NMMA, STA, and OKA on IbRPK expression in sweet potato (Ipomoea batatas cv. Tainung 57). Leaves with petiole cuts.
Rice SCAMP1 Defines Clathrin-Coated, trans- Golgi–Located Tubular- Vesicular Structures as an Early Endosome in Tobacco BY-2 Cells.

Rice SCAMP1 Defines Clathrin-Coated, trans- Golgi–Located Tubular- Vesicular Structures as an Early Endosome in Tobacco BY-2 Cells.
Cluster I. Cluster II Cluster III (contiued) Cluster IV.

Cluster I. Cluster II Cluster III (contiued) Cluster IV.
Analysis of the atp9 5‘ trailer A B At5S-5 Atatp9.Endo.Mega.A atp9 At5S-Mega.R (-239) (-84/- 83) (+180) 5S rRNA 5’ 3’ atp9 mRNA atp9 pre-mRNA atp9 5’ leader.

Analysis of the atp9 5‘ trailer A B At5S-5 Atatp9.Endo.Mega.A atp9 At5S-Mega.R (-239) (-84/- 83) (+180) 5S rRNA 5’ 3’ atp9 mRNA atp9 pre-mRNA atp9 5’ leader.
Fig. S1. Amino acid sequence alignment of MYBS3 proteins. MYBS3 protein sequences of Arabidopsis thaliana (MYBH; NP_199550); (At3g16350; NP_188256), Glycine.

Fig. S1. Amino acid sequence alignment of MYBS3 proteins. MYBS3 protein sequences of Arabidopsis thaliana (MYBH; NP_199550); (At3g16350; NP_188256), Glycine.
Fig. S1. Carotenoid and chlorophyll composition of Arabidopsis Z-ISO mutants compared to wild type. Seedlings were grown for 6d on half strength MS plus.

Fig. S1. Carotenoid and chlorophyll composition of Arabidopsis Z-ISO mutants compared to wild type. Seedlings were grown for 6d on half strength MS plus.
Supplementary Fig. S1: GO classification of 2,318 differentially expressed genes during fruit ripening in tomato. The genes which show differential expression.

Supplementary Fig. S1: GO classification of 2,318 differentially expressed genes during fruit ripening in tomato. The genes which show differential expression.

Similar presentations

Ads by Google